seo site checkup logo
PricingFree ToolsArticles
Report generated a year ago
https://www.medionesa.com/saran-hp-gaming-2-jutaan
Your general SEO Checkup Score
Archived
89/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 89 out of 100, which is higher than the average score of 75. Our analysis has identified 6 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
6 Failed
3 Warnings
64 Passed
Issues to fix
HIGH
To address URL canonicalization issues, it is recommended to select a primary URL for your webpage and set up redirects from all other variations to the preferred one.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
To enhance website performance, it is recommended to implement a caching mechanism that delivers static HTML content.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 93
Failed: 0
Warnings: 2
Passed: 23
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Saran HP Gaming 2 Jutaan: Pilihan Terbaik Untuk Gamer Hemat
Length: 59 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 129 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Temukan saran HP gaming 2 jutaan terbaik yang menawarkan performa optimal untuk bermain game favorit Anda tanpa menguras kantong.
Length: 129 characters
Google Search Results Preview Test
Desktop version
https://www.medionesa.com/saran-hp-gaming-2-jutaanSaran HP Gaming 2 Jutaan: Pilihan Terbaik Untuk Gamer HematTemukan saran HP gaming 2 jutaan terbaik yang menawarkan performa optimal untuk bermain game favorit Anda tanpa menguras kantong.
Mobile version
https://www.medionesa.com/saran-hp-gaming-2-jutaanSaran HP Gaming 2 Jutaan: Pilihan Terbaik Untuk Gamer HematTemukan saran HP gaming 2 jutaan terbaik yang menawarkan performa optimal untuk bermain game favorit Anda tanpa menguras kantong.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_US
og:type
article
og:title
Saran HP Gaming 2 Jutaan: Pilihan Terbaik Untuk Gamer Hemat
og:description
Temukan saran HP gaming 2 jutaan terbaik yang menawarkan performa optimal untuk bermain game favorit Anda tanpa menguras kantong.
og:url
https://www.medionesa.com/saran-hp-gaming-2-jutaan/
og:site_name
Medionesa
og:updated_time
2024-08-08T12:12:13+07:00
og:image
https://www.medionesa.com/wp-content/uploads/2024/08/Saran-HP-Gaming-2-Jutaan.webp
og:image:secure_url
https://www.medionesa.com/wp-content/uploads/2024/08/Saran-HP-Gaming-2-Jutaan.webp
og:image:width
1350
og:image:height
752
og:image:alt
Saran HP Gaming 2 Jutaan
og:image:type
image/webp
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
45yang34gaming27untuk23game21dengan
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
yang
gaming
untuk
game
dengan
Keywords Cloud Test
adalahakanaksesoriandaanggaranaplikasiataubaikbanyakbateraibeberapabermainbesarbisachipsetcommentscukupdalamdayadengandigunakandirekomendasikanemailfacebookgalaxygamegamergaminggrafishargaharusheliohematidealinciinfinixjutaankapasitaskeunggulankombinasikriteriakualitaslamalayarlebihmaksimalmampumasingmediatekmedionesamemastikanmembantumemberikanmemilihmemilikimenawarkanmendapatkanmenjagamenjalankanmodelmtechmumpuninarzonewsnoteolahragaoptimalpendinginpengalamanpengaturanpentingpenyimpananperangkatperformapertimbangkanpilihanpocoprosesorrealmeredmiresolusisamsungsangatsaransearchsepertisesuaisistemsnapdragontahantambahantanpaterbaiktetaptidaktinggitwitteruntukxiaomiyang
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Saran HP Gaming 2 Jutaan: Pilihan Terbaik untuk Gamer Hemat
H2 tags
Kriteria Penting dalam Memilih HP Gaming Murah
Saran HP Gaming 2 Jutaan Terbaik di Pasaran
Post navigation
Recent Posts
Categories
Archives
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test74% of top 100 sites passed
  • This website has a sitemap file.
SEO Friendly URL Test25% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test28% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test8% of top 100 sites passed
  • This webpage is not using inline CSS styles.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test41% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test57% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 93
Failed: 1
Warnings: 1
Passed: 23
HTML Page Size Test21% of top 100 sites passed
  • The size of this webpage's HTML is 31.0 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 531 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 150.96 Kb to 31.0 Kb (79% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 1.43 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage has less than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from the server, which will ultimately slow down the loading of your webpage.
Content size by content type
Content type
Percent
Size
javascript
69.1 %
101.79 Kb
html
29.8 %
43.91 Kb
image
1.1 %
1.55 Kb
css
0.0 %
0 B
font
0.0 %
0 B
other
0.0 %
0 B
TOTAL
100%
147.25 Kb
Requests by content type
Content type
Percent
Requests
html
33.3 %
1
javascript
33.3 %
1
image
33.3 %
1
css
0.0 %
0
font
0.0 %
0
other
0.0 %
0
TOTAL
100%
3
Content size by domain
Domain
Percent
Size
googletagmanager.com
69.1 %
101.79 Kb
medionesa.com
30.9 %
45.46 Kb
TOTAL
100%
147.25 Kb
Requests by domain
Domain
Percent
Requests
medionesa.com
66.7 %
2
googletagmanager.com
33.3 %
1
TOTAL
100%
3
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • It doesn't appear that this website is caching webpages. Cached pages serve up static html and avoid potentially time consuming queries to your database. It also helps lower server load by up to 80%. Caching most visibly benefits high traffic pages that access a database, but whose content does not change on every page view. Common caching methods include Alternative PHP Cache, Quickcache, and WP Super Cache (for Wordpress sites). Caching mechanisms also typically compress HTML, further reducing page size and load time.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test97% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using image resources!
Image Caching Test97% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test96% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test96% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is not using render-blocking resources.
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test98% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.756 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.756 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 1.168 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

1.168 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 1.45 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.45 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Saran HP Gaming 2 Jutaan: Pilihan Terbaik untuk Gamer Hemat
Html: <h1 class="entry-title" itemprop="headline">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0000. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.
0
Server and security
Score: 79
Failed: 2
Warnings: 0
Passed: 8
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.medionesa.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
medionesa.com
Subject Alternative Names (SANs)
medionesa.com, www.medionesa.com
Not valid before
Mon, August 5o 2024, 3:31:56 am (z)
Not valid after
Sun, November 3o 2024, 3:31:55 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R11
Intermediate certificate
Common name
R11
Organization
Let's Encrypt
Location
US
Not valid before
Wed, March 13o 2024, 12:00:00 am (z)
Not valid after
Fri, March 12o 2027, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test82% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test98% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test100% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 65
Failed: 3
Warnings: 0
Passed: 7
Structured Data Test53% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.medionesa.com/saran-hp-gaming-2-jutaan is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.medionesa.com/saran-hp-gaming-2-jutaan/" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:_spf.mail.hostinger.com ~all
Ads.txt Validation Test68% of top 100 sites passed
  • The request of ads.txt file has an unexpected Content-Type header: text/html; charset=UTF-8. In order for this resource to be easily accessed by the DSPs and advertisers, its Content-Type header should be text/plain or text/plain; charset=utf-8.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved