seo site checkup logo
PricingFree ToolsArticles
Report generated a year ago
https://www.maybank.co.id
Your general SEO Checkup Score
Archived
78/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 78 out of 100, which is higher than the average score of 75. Our analysis has identified 18 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
18 Failed
6 Warnings
48 Passed
Issues to fix
HIGH
To provide a good user experience, Google recommends that sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.
HIGH
To address URL canonicalization issues, it is recommended to select a primary URL for your webpage and set up redirects from all other variations to the preferred one.
HIGH
Minify all JavaScript files to reduce page size and loading time.
HIGH
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a Time To First Byte value of 0.8 seconds or less.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a First Contentful Paint value of 1.8 seconds or less.
MEDIUM
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
Common SEO issues
Score: 67
Failed: 3
Warnings: 4
Passed: 15
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 68 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Maybank Indonesia | Kemudahan Transaksi Finansial di Ujung Jari Anda
Length: 68 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 140 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Maybank menyediakan berbagai layanan perbankan bagi Anda, mulai dari pembukaan rekening, ajukan pinjaman, kpr, kartu kredit hingga investasi
Length: 140 characters
Google Search Results Preview Test
Desktop version
https://www.maybank.co.id/Maybank Indonesia | Kemudahan Transaksi Finansial di Ujung Jari AndaMaybank menyediakan berbagai layanan perbankan bagi Anda, mulai dari pembukaan rekening, ajukan pinjaman, kpr, kartu kredit hingga investasi
Mobile version
https://www.maybank.co.id/Maybank Indonesia | Kemudahan Transaksi Finansial di Ujung Jari AndaMaybank menyediakan berbagai layanan perbankan bagi Anda, mulai dari pembukaan rekening, ajukan pinjaman, kpr, kartu kredit hingga investasi
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:description
Maybank menyediakan berbagai layanan perbankan bagi Anda, mulai dari pembukaan rekening, ajukan pinjaman, kpr, kartu kredit hingga investasi
og:title
Maybank Indonesia | Kemudahan Transaksi Finansial di Ujung Jari Anda
og:url
https://www.maybank.co.id/
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
52maybank22indonesia16kredit13kartu11dengan
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
maybank
indonesia
kredit
kartu
dengan
Keywords Cloud Test
ajukanandaasetataubankbankingbawahbelanjaberbagaiberitabiayabisnisbonusbukabungacabangcicilandanadapatkandaridengandigitaldiskonekstraemasfilefinansialfiturforumgifthasilhemathinggaimbalindonesiainformasiinvestasikamikarirkartukebutuhankelolakemudahankeuangankreditlainnyalayananleaderslihatloginmatamaybankmudahmulainabungnilaionlinepembiayaanpemeliharaanpemilikanpenawaranpengumumanpetapilihpilihanpinjamanpraktispremierprivilegeprogrampromopromosiraihriburumahsekarangsemuasenayansentrashariahsimpanansistemsolutionssukusyariahtabungantanpatariftariktemukantentangterbarutipstransaksitutupuanguntukwealthyangzakat
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Selamat Malam!
Uploading File
Maybank Marathon
Artikel Terbaru
Corporate Online Services
H2 tags
Maybank QR Pay
Maybank Tabungan U atau U iB
360 Digital Wealth di M2U ID App
Berita & Pengumuman
Webinar & Event Maybank
Cabang & ATM Terdekat
Penawaran Terbaru
Tips Pintar Monitor & Kelola Keuangan dengan 360 Digital Wealth
Tips dan Cara Investasi Emas Secara Berkala di M2U ID App
Mudah dan Praktis Tarik Tunai Tanpa Kartu
Pilih Negara
Masukkan username Anda untuk memulai perbankan online
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test74% of top 100 sites passed
  • This website has a sitemap file.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test28% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test41% of top 100 sites passed
  • This webpage has some warnings caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Speed optimizations
Score: 51
Failed: 9
Warnings: 2
Passed: 9
HTML Page Size Test21% of top 100 sites passed
  • The size of this webpage's HTML is 27.05 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,077 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 121.83 Kb to 27.05 Kb (78% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 15.05 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 2 seconds!
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
49.9 %
2.40 Mb
javascript
44.5 %
2.14 Mb
css
3.5 %
172.98 Kb
font
1.6 %
79.60 Kb
html
0.5 %
23.02 Kb
other
0.1 %
2.79 Kb
TOTAL
100%
4.81 Mb
Requests by content type
Content type
Percent
Requests
image
53.2 %
92
javascript
29.5 %
51
other
7.5 %
13
css
6.9 %
12
font
1.7 %
3
html
1.2 %
2
TOTAL
100%
173
Content size by domain
Domain
Percent
Size
maybank.co.id
78.3 %
3.77 Mb
googletagmanager.com
8.9 %
436.37 Kb
gstatic.com
4.1 %
200.29 Kb
maps.googleapis.com
3.9 %
192.21 Kb
connect.facebook.net
1.6 %
78.18 Kb
s.go-mpulse.net
1.0 %
50.61 Kb
google-analytics.com
0.8 %
39.40 Kb
cdn.adjust.com
0.6 %
27.82 Kb
amp.azure.net
0.4 %
19.19 Kb
ssl.google-analytics.com
0.3 %
17.06 Kb
Other
0.2 %
10.58 Kb
TOTAL
100%
4.81 Mb
Requests by domain
Domain
Percent
Requests
maybank.co.id
76.9 %
133
googletagmanager.com
2.9 %
5
maps.googleapis.com
2.3 %
4
google.com
2.3 %
4
google-analytics.com
2.3 %
4
connect.facebook.net
1.7 %
3
analytics.google.com
1.7 %
3
stats.g.doubleclick.net
1.7 %
3
facebook.com
1.2 %
2
googleads.g.doubleclick.net
1.2 %
2
Other
5.8 %
10
TOTAL
100%
173
CDN Usage Test97% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test97% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test96% of top 100 sites passed
  • This webpage is using JavaScript files that are not minified!
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test98% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 4.570 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

4.57 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 6.642 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

6.642 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 14.37 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

14.37 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img src="/-/media/Feature/Carousel/Carousel-Home/445x770px-..." alt="maybank" class="slide-img">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0024. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0024

0.1

0.25

DOM element which contributes the most to CLS score:
Html: <div class="bubble cs-typing hidden">
Score: 0.0012
Server and security
Score: 68
Failed: 2
Warnings: 0
Passed: 5
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.maybank.co.id" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.maybank.co.id
Organization
PT BANK MAYBANK INDONESIA TBK
Location
Bandung, Jawa Barat, ID
Subject Alternative Names (SANs)
*.maybank.co.id, maybank.co.id
Not valid before
Sun, June 25o 2023, 12:00:00 am (z)
Not valid after
Tue, June 25o 2024, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
DigiCert TLS RSA SHA256 2020 CA1
Intermediate certificate
Common name
DigiCert TLS RSA SHA256 2020 CA1
Organization
DigiCert Inc
Location
US
Not valid before
Wed, April 14o 2021, 12:00:00 am (z)
Not valid after
Sun, April 13o 2031, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
DigiCert Global Root CA
Root certificate
Common name
DigiCert Global Root CA
Organization
DigiCert Inc
Location
US
Not valid before
Fri, November 10o 2006, 12:00:00 am (z)
Not valid after
Mon, November 10o 2031, 12:00:00 am (z)
Signature algorithm
sha1WithRsaEncryption
Issuer
DigiCert Global Root CA
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test82% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000
Plaintext Emails Test100% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0, user-scalable=no, minimum-scale=1.0, maximum-scale=1.0" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 65
Failed: 2
Warnings: 0
Passed: 7
Structured Data Test53% of top 100 sites passed
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • The robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 mx a ip4:103.247.183.54 ip4:103.247.183.55 ip4:103.247.183.119 ip4:103.247.183.56 ip4:103.247.182.108 ip4:103.247.182.103 ip4:103.247.182.90 include:spf01.maybank.co.id include:ncapp02.com -all
Ads.txt Validation Test68% of top 100 sites passed
  • The request of ads.txt file has an unexpected Content-Type header: text/html; charset=utf-8. In order for this resource to be easily accessed by the DSPs and advertisers, its Content-Type header should be text/plain or text/plain; charset=utf-8.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved