seo site checkup logo
PricingFree ToolsArticles
Report generated 3 days ago
https://www.lycamobile.ie/en
Your general SEO Checkup Score
Archived
78/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 78 out of 100, which is higher than the average score of 75. Our analysis has identified 12 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
12 Failed
5 Warnings
55 Passed
Issues to fix
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
Reducing the JavaScript execution time can result in faster page load times and a smoother user experience, as it allows the browser to render and display the page more quickly.
MEDIUM
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
Common SEO issues
Score: 75
Failed: 5
Warnings: 2
Passed: 18
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 61 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Ireland Prepaid SIM Cards & Pay As You Go Plans - Lyca Mobile
Length: 61 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Lyca Mobile Ireland has a mobile plan to suit your needs, with Pay As You Go plans, prepaid plans and more. Explore our deals and order your free SIM card.
Length: 155 characters
Google Search Results Preview Test
Desktop version
https://www.lycamobile.ie/en/Ireland Prepaid SIM Cards & Pay As You Go Plans - Lyca MobileLyca Mobile Ireland has a mobile plan to suit your needs, with Pay As You Go plans, prepaid plans and more. Explore our deals and order your free SIM card.
Mobile version
https://www.lycamobile.ie/en/Ireland Prepaid SIM Cards & Pay As You Go Plans - Lyca MobileLyca Mobile Ireland has a mobile plan to suit your needs, with Pay As You Go plans, prepaid plans and more. Explore our deals and order your free SIM card.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:title
Ireland Prepaid SIM Cards & Pay As You Go Plans - Lyca Mobile
og:description
LycaMobile Ireland has a mobile plan to suit your needs, with Pay As You Go plans, prepaid plans and more. Explore our deals and order your free SIM card.
og:locale
en_gb
og:image
https://cms-assets.ldsvcplatform.com/IRE/s3fs-public/2023-09/home_logo.png
og:height
123
og:width
314
og:sitename
Lyca Mobile IE
og:type
Home
og:url
https://www.lycamobile.ie/en/
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
27cookies12lyca10plans10information8site
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
cookies
lyca
plans
information
site
Keywords Cloud Test
ableaccessibilityaccountaddressadvertisingallowbangladeshbestbrowserbulgariacallscancelchangecheapcheckcheckboxchooseclickconsentcontentcontractcookiecookiesdetailsdevicedirectlydiscountsdownloademailenableenterexperiencefeedbackfreefriendfunctionfunctionalguidehavehelpimproveindiainformationinternationalirelandissuejoinknowlabellycamainmanagemobilemodenecessarynigeriaoffersoptionpagespakistanperformancepersonalplanplanspluspolandpolicypreferencesprepaidprepaypressprivacypurposesquickreaderreferrelevantrenewreportingromaniasavescreenscriptsecurityservicesshankarsitesitesskipstoresupportswitchtargetingtodaytypesusedusuallywebsitewindowwork
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Join Lyca today
Best Value
Save more
Go international
H2 tags
Already with Lyca?
Choose a SIM only plan today
Why Lyca?
Download iOS/Android
My Lyca Mobile app
We are here to help you
View our recent blogs
Sign up to get exclusive offers
Join Lyca Mobile
Quick links
Help & support
Lyca Mobile Ireland
Lyca on the go
Skip to Main Content - Keyboard Accessible
Why we use cookies and other tracking technologies?
Privacy Preference Center
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
SEO Friendly URL Test29% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test78% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Inline CSS Test10% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test27% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Social Media Test75% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 72
Failed: 5
Warnings: 3
Passed: 17
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 839 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 659.83 Kb to 169.32 Kb (74% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 0.88 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 3.5 seconds! When the JavaScript code takes a long time to execute, it slows down the page performance in several ways: longer download times, main thread bottlenecks, delays of "Time To Interactive", memory leaks, etc.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
47.1 %
1.84 Mb
javascript
39.1 %
1.53 Mb
font
9.2 %
369.90 Kb
css
2.4 %
95.51 Kb
other
1.8 %
71.33 Kb
html
0.4 %
15.21 Kb
TOTAL
100%
3.91 Mb
Requests by content type
Content type
Percent
Requests
image
41.7 %
65
javascript
30.1 %
47
css
13.5 %
21
other
10.3 %
16
font
3.2 %
5
html
1.3 %
2
TOTAL
100%
156
Content size by domain
Domain
Percent
Size
cms-assets.ldsvcplatform.com
46.5 %
1.82 Mb
lycamobile.ie
33.0 %
1.29 Mb
dev.visualwebsiteoptimizer.com
6.0 %
238.97 Kb
acsbapp.com
5.2 %
209.01 Kb
cdn.cookielaw.org
4.4 %
176.16 Kb
googletagmanager.com
2.4 %
96.12 Kb
assets.adobedtm.com
2.3 %
92.04 Kb
lycamobile.demdex.net
0.1 %
3.18 Kb
s3-eu-west-2.amazonaws.com
0.1 %
2.77 Kb
dpm.demdex.net
0.0 %
1.52 Kb
Other
0.0 %
988 B
TOTAL
100%
3.91 Mb
Requests by domain
Domain
Percent
Requests
lycamobile.ie
47.4 %
74
cms-assets.ldsvcplatform.com
31.4 %
49
cdn.cookielaw.org
6.4 %
10
dev.visualwebsiteoptimizer.com
5.8 %
9
assets.adobedtm.com
3.2 %
5
dpm.demdex.net
1.3 %
2
googletagmanager.com
0.6 %
1
s3-eu-west-2.amazonaws.com
0.6 %
1
acsbapp.com
0.6 %
1
lycamobile.demdex.net
0.6 %
1
Other
1.9 %
3
TOTAL
100%
156
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test100% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test97% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.166 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.166 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 2.743 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

2.743 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 4.0 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

4 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<div class="MuiGrid-root css-15i4een" tabindex="-1" style="width: 100%; display: inline-block;">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0675. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0675

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Choose a SIM only plan today Get the best deals on SIM Only Prepay Plans which ...
Html: <div class="ChooseSimOnlyPlanOneByTwo_main_div__bIiLK MuiBox-r..." id="choose-blocks-container-one-by-two">
Score: 0.0633
Server and security
Score: 100
Failed: 0
Warnings: 0
Passed: 10
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.lycamobile.ie" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.lycamobile.ie
Organization
Lycatel Services LTD
Location
London, GB
Subject Alternative Names (SANs)
*.lycamobile.ie, lycamobile.ie
Not valid before
Fri, January 3o 2025, 12:00:00 am (z)
Not valid after
Tue, February 3o 2026, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
Network Solutions RSA OV SSL CA 3
Intermediate certificate
Common name
Network Solutions RSA OV SSL CA 3
Organization
Network Solutions L.L.C.
Location
US
Not valid before
Wed, August 2o 2023, 12:00:00 am (z)
Not valid after
Mon, August 1o 2033, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Root certificate
Common name
USERTrust RSA Certification Authority
Organization
The USERTRUST Network
Location
Jersey City, New Jersey, US
Not valid before
Mon, February 1o 2010, 12:00:00 am (z)
Not valid after
Mon, January 18o 2038, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000; includesubdomains
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test95% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="initial-scale=1.0, width=device-width, maximum-scale=2.0, user-scalable=yes" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 65
Failed: 2
Warnings: 0
Passed: 7
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.lycamobile.ie/en/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link data-next-head="" href="https://www.lycamobile.ie/en/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • The robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 mx include:lyca_spf1.lycagroup.com include:amazonses.com a:uklneqntp1.lycamobile.co.uk a:uklneqntp2.lycamobile.co.uk a:uklneqntp3.lycamobile.uk -all
Ads.txt Validation Test67% of top 100 sites passed
  • The request of ads.txt file has an unexpected Content-Type header: text/html; charset=utf-8. In order for this resource to be easily accessed by the DSPs and advertisers, its Content-Type header should be text/plain or text/plain; charset=utf-8.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved