seo site checkup logo
PricingFree ToolsArticles
Report generated 3 hours ago
https://www.lovelymessages.com
Your general SEO Checkup Score
Archived
65/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 65 out of 100, which is below the average score of 75. However, there are 15 SEO issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
15 Failed
5 Warnings
41 Passed
Issues to fix
HIGH
To provide a good user experience, Google recommends that sites should aim for a Cumulative Layout Shift score of 0.1 or less.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
HIGH
Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Consider reducing the HTML size to improve loading times and retain visitors.
LOW
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 69
Failed: 4
Warnings: 2
Passed: 16
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Lovely Messages | Spreading Love, One Message at a Time!
Length: 56 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 117 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Lovely Messages is the best site for sharing heart touching lovely messages that you can send to the people you love.
Length: 117 characters
Google Search Results Preview Test
Desktop version
https://www.lovelymessages.com/Lovely Messages | Spreading Love, One Message at a Time!Lovely Messages is the best site for sharing heart touching lovely messages that you can send to the people you love.
Mobile version
https://www.lovelymessages.com/Lovely Messages | Spreading Love, One Message at a Time!Lovely Messages is the best site for sharing heart touching lovely messages that you can send to the people you love.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:url
https://www.lovelymessages.com/
og:title
Lovely Messages | Spreading Love, One Message at a Time!
og:description
Lovely Messages is the best site for sharing heart touching lovely messages that you can send to the people you love.
og:type
website
og:site_name
Lovely Messages | Spreading Love, One Message at a Time!
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
72messages49love26family25heartfelt17communication
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
messages
love
family
heartfelt
communication
Keywords Cloud Test
albumandrewanniversaryapologyappreciationbasketsbeautyblogcarecelebratecelebratingcommitmentcommunicatecommunicationcondolencescongratulationsconnectioncontentcorrespondentdailydecemberdevotiondiscoveremotionalexpressfamilyforeverfriendsfriendshipgenuinegiftgoodguestsheartheartfelthomehopehttpsinspirationinspireinvitationjunelastingleavelifeloadinglovelovelylovelymessagesmagneticmakemeaningfulmendmessagemessagesmomentmorningmotivationmotivationalmusicnsikakofferparagraphspartnerspeoplepersonalpetsphotopidginpoemspostsprayersproverbsquotesreadmorerecentreflectionsrelationshiprelationshipsrememberromanticscholarshipscholarshipssearchsharesharedsharingsoulspecialspreadingstudentssupportthanktimetravelvideosviewwarmthwisheswords
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Lovely Messages | Spreading Love, One Message at a Time!
H2 tags
Scholarships
Relationships
Family
Love
Videos
Motivation
Prayers
Condolences
Congratulations
Latest Posts
Week Trending
140 Support Messages to Inspire Strength and Hope During Challenging Moments
170 Touching Tribute Messages for Deceased Loved Ones to Express Eternal Love, Respect, and Heartfelt Remembrance During Funerals and Memorials
220 Heartfelt Good Morning Messages for Her to Make Her Smile All Day
200+ Romantic Good Morning Love Messages and Wishes to Melt Your Partner's Heart
240 Sweet and Romantic Good Morning Texts to Make Him or Her Smile
Recent With Thumbs
Recent Replies Random
Most Popular
Categories
LovelyMessages.com – Heartfelt Messages, Quotes, and Poems for Every Occasion
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test27% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 48
Failed: 8
Warnings: 3
Passed: 9
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,771 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 1953.1 Kb to 332.96 Kb (83% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 8.88 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 2 seconds!
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
46.7 %
1.34 Mb
image
35.5 %
1.02 Mb
html
9.4 %
276.53 Kb
font
7.4 %
218.87 Kb
other
0.6 %
16.46 Kb
css
0.5 %
13.60 Kb
TOTAL
100%
2.87 Mb
Requests by content type
Content type
Percent
Requests
image
39.3 %
55
javascript
27.9 %
39
html
17.1 %
24
other
7.1 %
10
css
4.3 %
6
font
4.3 %
6
TOTAL
100%
140
Content size by domain
Domain
Percent
Size
blogger.googleusercontent.com
34.0 %
1001.48 Kb
pagead2.googlesyndication.com
17.1 %
502.67 Kb
lovelymessages.com
12.5 %
369.23 Kb
googletagmanager.com
9.6 %
281.54 Kb
fundingchoicesmessages.google.com
5.4 %
158.01 Kb
fonts.gstatic.com
4.9 %
143.25 Kb
googleads.g.doubleclick.net
2.9 %
84.91 Kb
maxcdn.bootstrapcdn.com
2.8 %
83.00 Kb
platform-api.sharethis.com
2.0 %
59.30 Kb
tpc.googlesyndication.com
1.8 %
52.48 Kb
Other
7.1 %
207.74 Kb
TOTAL
100%
2.87 Mb
Requests by domain
Domain
Percent
Requests
blogger.googleusercontent.com
22.1 %
31
fundingchoicesmessages.google.com
13.6 %
19
pagead2.googlesyndication.com
10.0 %
14
googleads.g.doubleclick.net
6.4 %
9
platform-cdn.sharethis.com
5.7 %
8
lovelymessages.com
5.0 %
7
tpc.googlesyndication.com
5.0 %
7
notix.io
4.3 %
6
fonts.gstatic.com
3.6 %
5
sync.sharethis.com
3.6 %
5
Other
20.7 %
29
TOTAL
100%
140
CDN Usage Test95% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test95% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.072 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.072 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 1.044 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

1.044 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 2.64 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

2.64 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img src="https://blogger.googleusercontent.com/img/b/R29vZ2..." class="optimized">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.8020. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.802

0.1

0.25

DOM element which contributes the most to CLS score:
Text: 0 Nsikak Andrew Nov 15, 2025 120 Heartfelt Beauty and Lifestyle Messages to Ins...
Html: <div id="inner-primary" style="height: auto !important;">
Score: 0.3638
Server and security
Score: 84
Failed: 2
Warnings: 0
Passed: 5
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.lovelymessages.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
www.lovelymessages.com
Subject Alternative Names (SANs)
www.lovelymessages.com
Not valid before
Sun, October 5o 2025, 1:43:17 am (z)
Not valid after
Sat, January 3o 2026, 2:31:47 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
WR3
Root certificate
Common name
WR3
Organization
Google Trust Services
Location
US
Not valid before
Wed, December 13o 2023, 9:00:00 am (z)
Not valid after
Tue, February 20o 2029, 2:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GTS Root R1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width,initial-scale=1.0,minimum-scale=1.0" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 76
Failed: 1
Warnings: 0
Passed: 8
Structured Data Test66% of top 100 sites passed
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.lovelymessages.com/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.lovelymessages.com/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:spf.efwd.registrar-servers.com ~all
Ads.txt Validation Test67% of top 100 sites passed
  • This website is using an Authorized Digital Sellers (ads.txt) file and its content has a valid format. Since the file is uploaded and maintained by publishers on their own domain, it's not easy for bad players to gain access to it or to change entries. Buyers who want to bid on the publisher's inventory can refer to their ads.txt file and confidently know that the exchange they are dealing with is in fact authorized to directly or indirectly sell the publisher's inventory.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved