seo site checkup logo
PricingFree ToolsArticles
Report generated 8 months ago
https://www.lastjourney.in/cremation-ground-delhi-ncr/lodhi-road-cremation-ground
Your general SEO Checkup Score
Archived
84/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 84 out of 100, which is higher than the average score of 75. Our analysis has identified 11 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
11 Failed
3 Warnings
59 Passed
Issues to fix
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Serving resources (images, JS, CSS) from a CDN service, could improve website loading times, reduce bandwidth costs and increase content availability and redundancy.
MEDIUM
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
For security reasons, it is recommended to turn off the server signature.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 84
Failed: 4
Warnings: 0
Passed: 21
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Lodhi Road Cremation Ground, Contact Number, Timings & Cost
Length: 59 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Dayanand Mukti Dhan, Lodhi Road Crematorium is a suitable option for performing the last rites of your loved ones with electric or wooden cremation options
Length: 155 characters
Google Search Results Preview Test
Desktop version
https://www.lastjourney.in/cremation-ground-delhi-ncr/lodhi-road-cremation-ground/Lodhi Road Cremation Ground, Contact Number, Timings & CostDayanand Mukti Dhan, Lodhi Road Crematorium is a suitable option for performing the last rites of your loved ones with electric or wooden cremation options
Mobile version
https://www.lastjourney.in/cremation-ground-delhi-ncr/lodhi-road-cremation-ground/Lodhi Road Cremation Ground, Contact Number, Timings & CostDayanand Mukti Dhan, Lodhi Road Crematorium is a suitable option for performing the last rites of your loved ones with electric or wooden cremation options
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:image
https://www.lastjourney.in/uploaded_files/category/d1.jpg
og:locale
en_US
og:type
article
og:title
Lodhi Road Cremation Ground, Contact Number, Timings & Cost
og:description
Dayanand Mukti Dhan, Lodhi Road Crematorium is a suitable option for performing the last rites of your loved ones with electric or wooden cremation options
og:url
https://www.lastjourney.in/cremation-ground-delhi-ncr/lodhi-road-cremation-ground/
og:site_name
Last Journey
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
64cremation43services33ground28road27lodhi
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
cremation
services
ground
road
lodhi
Keywords Cloud Test
accordingaddressambulanceantimareaarrangementassistanceasthiauditoriumavailablebodybookchamberchauthachoicecomfortcompleteconnectivitycoordinationcostcremationcrematoriumdeceaseddecordecorateddecorationdelhidubaielectricexperiencedfamiliesfamilyflowersfreefreezerfuneralgarlandsghatgoodgreengroundgroundshallhasslehavehearsehelphinduhomeincludingindiaiskconitemsjourneyknowlocationlodhilogslovedmembersmortuarymumbaineednizamuddinpanditpanelpaperworkpeacepeopleplaceprayerprocessprovideprovisionpyrequickritesritualsroadsamagrisandalwoodsanskarselectservicesshamshanstaffstepsupportteamtehravintempletimetimestransporttransportationvastvisarjanwestwoodwork
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Lodhi Road Cremation Ground Nizamuddin
H2 tags
We offer end-to-end services
History and Significance of Lodhi Road Crematorium
Why Lodhi Road Crematorium is Best Choice:
Cost of Cremation at Lodhi Road Crematorium
Lists of Cremation Grounds Near Delhi
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test74% of top 100 sites passed
  • This website has a sitemap file.
SEO Friendly URL Test25% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test28% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test8% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test41% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test57% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 83
Failed: 3
Warnings: 1
Passed: 21
HTML Page Size Test21% of top 100 sites passed
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,423 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 161.29 Kb to 36.31 Kb (77% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 2.08 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage has less than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from the server, which will ultimately slow down the loading of your webpage.
Content size by content type
Content type
Percent
Size
image
55.7 %
186.61 Kb
javascript
22.3 %
74.74 Kb
html
10.8 %
36.21 Kb
font
7.2 %
24.04 Kb
css
4.0 %
13.29 Kb
other
0.0 %
0 B
TOTAL
100%
334.89 Kb
Requests by content type
Content type
Percent
Requests
javascript
40.0 %
6
image
26.7 %
4
css
20.0 %
3
html
6.7 %
1
font
6.7 %
1
other
0.0 %
0
TOTAL
100%
15
Content size by domain
Domain
Percent
Size
lastjourney.in
100.0 %
334.89 Kb
TOTAL
100%
334.89 Kb
Requests by domain
Domain
Percent
Requests
lastjourney.in
100.0 %
15
TOTAL
100%
15
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test97% of top 100 sites passed
  • This webpage is not serving resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test97% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test96% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is not using render-blocking resources.
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test98% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.388 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.388 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 1.090 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

1.09 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 2.18 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

2.18 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Lodhi Road From coordination to decoration, get complete assistance across our ...
Html: <div class="splide__slide hero-container is-active is-visible" style="background-image: url("https://www.lastjourney.in/..." id="splide01-slide01" role="tabpanel" aria-roledescription="slide" aria-label="1 of 2">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0221. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0221

0.1

0.25

DOM element which contributes the most to CLS score:
Text: List Of Services In The Cremation Ground Wood Pyre and Electric Cremation Availa...
Html: <div class="wedo">
Score: 0.0211
Server and security
Score: 78
Failed: 3
Warnings: 1
Passed: 6
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using the HTTPS protocol, but the SSL Certificate will expire in less than a month! Having an up-to-date certificate is an important security practice to ensure that your website is safe and provides trust, and any communication between the user's browser and your website (such as passwords, credit cards, or forms) is encrypted and private.

The certificate is not used before the activation date.

The certificate will expire in less than a month!

The hostname "www.lastjourney.in" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
lastjourney.in
Subject Alternative Names (SANs)
lastjourney.in, www.lastjourney.in
Not valid before
Tue, August 13o 2024, 9:25:05 am (z)
Not valid after
Mon, November 11o 2024, 9:25:04 am (z)
Signature algorithm
ecdsaWithSha384
Issuer
E5
Intermediate certificate
Common name
E5
Organization
Let's Encrypt
Location
US
Not valid before
Wed, March 13o 2024, 12:00:00 am (z)
Not valid after
Fri, March 12o 2027, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test82% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test98% of top 100 sites passed
Server: Apache/2.4.51 (Unix) OpenSSL/1.1.1n
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test100% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 90
Failed: 1
Warnings: 1
Passed: 8
Structured Data Test53% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
<link href="https://www.lastjourney.in/cremation-ground-delhi-ncr/lodhi-road-cremation-ground/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test68% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved