seo site checkup logo
PricingFree ToolsArticles
Report generated 7 years ago
http://www.kitchencafee.com/deals
Your general SEO Checkup Score
Archived
60/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 60 out of 100, which is below the average score of 75. However, there are 13 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
13 Failed
1 Warnings
26 Passed
Common SEO issues
Score: 77
Failed: 3
Warnings: 0
Passed: 12
Google Search Results Preview Test
Desktop version
http://www.kitchencafee.com/dealsDeals of the cookware and appliances - Kitchen cafeKitchen cafe as a company born out for 'love of cooking' as our belief that kitchen is the 'heart of our home' we have so many memories connected with food cook for our loved ones.So kitchen cafe gives you best deal of cookware and appliances of different brands with their functions and with demo video.
Mobile version
http://www.kitchencafee.com/dealsDeals of the cookware and appliances - Kitchen cafeKitchen cafe as a company born out for 'love of cooking' as our belief that kitchen is the 'heart of our home' we have so many memories connected with food cook for our loved ones.So kitchen cafe gives you best deal of cookware and appliances of different brands with their functions and with demo video.
Keywords Cloud Test
aluminiumaluminumamazonanodizedaprilautobakingbasketbestbetterbladebodycapacitycare@wonderchef.incasserolecleancoatingcolorcomescomparecontactcontentscontrolconvenientcookercookingdesigndistributiondosadoubledougheasyelectricemailextrafasterfoodfreefryingfunctionglassgradegrindergrindinghandhandlehandleshealthyheatheavyincludesinductioninformationitemsjarsjuicerkitchenlitrelitresmakemanualmanufacturer’smaterialmixermotornonsticknumberoperatingpackagepansperfectpfoapizzapowerproductpurerackrecipesafesafetysavingsimilarsoftspeedstainlesssteamingsteelstorestylishtawatouchvoltagevoltswaffledwarrantywaterwattswonderchefyearyears
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! We've found 2 sitemaps files for your website:
SEO Friendly URL Test
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test
  • Your webpage has 64 'img' tags and 61 of them are missing the required 'alt' attribute.
See full list
Inline CSS Test
  • Your webpage is using 10 inline CSS styles!
See results list
Deprecated HTML Tags Test
  • We found some HTML deprecated tags. You are advised to change these old tags with equivalent tags or proper CSS rules.
Google Analytics Test
  • Congratulations! Your website is using the latest version of Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your web page.
Social Media Test
  • Congratulations! Your website is connected successfully with social media using: Facebook;
Speed optimizations
Score: 30
Failed: 6
Warnings: 1
Passed: 4
HTML Page Size Test
HTML Compression/GZIP Test
  • Your page do not use any HTML compression!
    You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 83 % - from 166.18 Kb to 28.58 Kb which would further reduce your page loading time.
Site Loading Speed Test
  • Your site loading time is around 13.41 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
Total Objects: 142
  • 8 HTML Pages
  • 16 CSS Files
  • 49 JS Files
  • 69 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • It does not appear that you are caching your pages. Cached pages serve up static html and avoid potentially time consuming queries to your database. It also helps lower server load by up to 80%. Caching most visibly benefits high traffic pages that access a database, but whose content does not change on every page view. Common caching methods include Alternative PHP Cache, Quickcache, and WP Super Cache (for Wordpress sites). Caching mechanisms also typically compress HTML, further reducing page size and load time.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Your site is not using expires headers for your images. An expires tag can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test
  • Your URL performed one redirect! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 0
Failed: 3
Warnings: 0
Passed: 2
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
Server: Apache/2.4.33 (cPanel) OpenSSL/1.0.2o mod_bwlimited/1.4 Phusion_Passenger/5.1.12
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We found 2 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Advanced SEO
Score: 80
Failed: 1
Warnings: 0
Passed: 5
Structured Data Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your page is using the canonical link tag. This tag specifies that the URL: http://www.kitchencafee.com/deals is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link rel="canonical" href="http://www.kitchencafee.com/deals/" />
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
SPF Records Test
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved