seo site checkup logo
PricingFree ToolsArticles
Report generated 7 years ago
https://www.kala.ir/category/mobile
Your general SEO Checkup Score
Archived
87/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 87 out of 100, which is higher than the average score of 75. Our analysis has identified 7 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
7 Failed
0 Warnings
42 Passed
Common SEO issues
Score: 85
Failed: 3
Warnings: 0
Passed: 18
Meta Title
  • Congratulations! Your webpage is using a title tag
Text: خرید اینترنتی موبایل- فروشگاه اینترنتی kala-ir
Meta Description
  • Congratulations! Your webpage is using a meta description tag
Text: خرید اینترنتی موبایل kala-ir. خرید آنلاین بهترین برندهای موبایل, اپل, سامسونگ, هواوی, نوکیا و ...مرجع انواع موبایل با گارانتی. ارسال رایگان.
Google Search Results Preview
Desktop version
https://www.kala.ir/category/mobileخرید اینترنتی موبایل- فروشگاه اینترنتی kala-irخرید اینترنتی موبایل kala-ir. خرید آنلاین بهترین برندهای موبایل, اپل, سامسونگ, هواوی, نوکیا و ...مرجع انواع موبایل با گارانتی. ارسال رایگان.
Mobile version
https://www.kala.ir/category/mobileخرید اینترنتی موبایل- فروشگاه اینترنتی kala-irخرید اینترنتی موبایل kala-ir. خرید آنلاین بهترین برندهای موبایل, اپل, سامسونگ, هواوی, نوکیا و ...مرجع انواع موبایل با گارانتی. ارسال رایگان.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
57keyboard_arrow_left18close17kala.ir9check7arrow_forward
Keywords Usage Test
  • Your most common keywords are not appearing in one or more of the meta-tags above. Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines.
Keyword(s) not included in Title tag
Keyword(s) not included in Meta-Description tag
Keywords Cloud
account_boxall-in-oneandroidapplearrow_forwardasusblackberrycard_membershipcaterpillarcheckclosecopyrightdeletedelldetailsdslremailfavoriteheadset_michelphuaweiinfoinfo@kala.irinfo_outlineiphonekala.irkeyboard_arrow_leftkeyboard_arrow_uplenovolocation_onlockmenumessagemobilemore_vertmotorolanokianotificationspaymentpersonplacequestion_answerremove_red_eyereservedrightssamsungsearchsecuritysettingsshopping_cartsmartphonesonyxiaomi
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Congratulations! Your webpage contains headings tags.
H1 tags
موبایل close
H2 tags
دسته بندی محصولات
ویژه ها
خرید گوشی از فروشگاه اینترنتی kala.ir
انواع گوشی موبایل (انتخاب بهترین گوشی موبایل):
خرید اینترنتی موبایل با بهترین قیمت
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Your site lacks a sitemap file. Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test
  • All of your webpage's "img" tags have the required "alt" attribute.
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your webpage.
Social Media Check
  • Congratulations! Your website is connected successfully with social media using:
Facebook Google Plus Twitter 
Speed optimizations
Score: 78
Failed: 3
Warnings: 0
Passed: 10
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 280.04 Kb to 35.72 Kb (87% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 5.54 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 51
  • 1 HTML Pages
  • 1 CSS Files
  • 4 JS Files
  • 45 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Congratulations! Your webpage is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Minification Test
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test
  • Congratulations! Your website's CSS files are minified!
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Checker
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 91
Failed: 1
Warnings: 0
Passed: 5
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We've found 3 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 100
Failed: 0
Warnings: 0
Passed: 7
Microdata Schema Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://www.kala.ir/category/mobile is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.kala.ir/category/mobile" rel="canonical"/>
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF records checker
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 mx a ip4:109.230.64.17 ~all
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved