seo site checkup logo
PricingFree ToolsArticles
Report generated 8 hours ago
https://www.jptrip.cc/sitemap.xml
Your general SEO Checkup Score
Archived
68/100
SEO Score
Average SEO score of top 100 sites: 74%
This website received an SEO score of 68 out of 100, which is below the average score of 74. However, there are 18 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
18 Failed
1 Warnings
55 Passed
Issues to fix
HIGH
To address URL canonicalization issues, it is recommended to select a primary URL for your webpage and set up redirects from all other variations to the preferred one.
HIGH
Add a descriptive and relevant title tag to the webpage, targeting important keywords or phrases, as a missing or poor title tag can make it difficult for the page to rank well in search engines.
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
Add a meta description tag to provide a brief and informative summary of the page's content for search engines.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Add a Viewport Meta Tag to optimize this webpage for mobile screens. Without a viewport meta tag, mobile devices may render pages at typical desktop screen widths, resulting in pages being scaled down and difficult to read.
HIGH
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
HIGH
Connect your webpage with social media networks using APIs or AddThis, as social signals are becoming increasingly important for search engines to validate a site's trustworthiness and authority.
HIGH
To implement responsive design functionalities, it is recommended to use CSS media queries.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
To enhance website performance, it is recommended to implement a caching mechanism that delivers static HTML content.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
MEDIUM
Using social media meta tags can improve the appearance and content of shared links on social media platforms, potentially increasing click-through rates and engagement with the page.
LOW
A proper character encoding declaration ensures that all characters, including non-ASCII characters, are displayed correctly in the browser, improving the readability and usability of the webpage.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
LOW
This website either lacks a favicon or it has not been referenced properly.
Common SEO issues
Score: 47
Failed: 10
Warnings: 0
Passed: 16
Meta Title Test100% of top 100 sites passed
  • This webpage is not using a title tag! A missing or poor title tag (that does not target important keywords or phrases) will make it difficult for your page to rank well in search engines.
Meta Description Test96% of top 100 sites passed
  • This webpage is not using a meta description tag! You should include this tag in order to provide a brief description of your page which can be used by search engines. Well-written and inviting meta descriptions may also help click-through rates to your site in search engine results.
Google Search Results Preview Test
Desktop version
https://www.jptrip.cc/sitemap.xml
Mobile version
https://www.jptrip.cc/sitemap.xml
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
6https6jptrip6lastmod6changefreq6priority
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
https
jptrip
lastmod
changefreq
priority
Keywords Cloud Test
appearassociatedchangefreqdailydocumentdoesfileguidehavehtmlhttphttpsinformationjptriplastmodnewspriorityschemasshownsitemapsitemapsstyletraveltreeurlsetweeklyxmlns
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test74% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test25% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • This webpage doesn't use "img" tags.
Responsive Image Test28% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test8% of top 100 sites passed
  • This webpage is not using inline CSS styles.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • This website either doesn't have a favicon or this has not been referenced correctly!
JS Error Test79% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test41% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage doesn't have a character encoding declaration! If the server doesn't specify which character encoding format it's using when it sends an HTML file, the browser may display some characters incorrectly. A character encoding declaration is required (either in the Content-Type header or explicitly in the file using a meta tag) even when all characters are in the ASCII range, because a character encoding is needed to process non-ASCII characters entered by the user in forms, in URLs generated by scripts, and so forth.
Social Media Test57% of top 100 sites passed
  • This webpage is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 96
Failed: 2
Warnings: 0
Passed: 23
HTML Page Size Test21% of top 100 sites passed
  • The size of this webpage's HTML is 1.15 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 123 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using zstd compression on your code. The HTML code is compressed from 5.53 Kb to 1.15 Kb (79% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 0.83 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage has less than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from the server, which will ultimately slow down the loading of your webpage.
Content size by content type
Content type
Percent
Size
other
53.2 %
917 B
html
46.8 %
808 B
css
0.0 %
0 B
javascript
0.0 %
0 B
image
0.0 %
0 B
font
0.0 %
0 B
TOTAL
100%
1.68 Kb
Requests by content type
Content type
Percent
Requests
html
50.0 %
1
other
50.0 %
1
css
0.0 %
0
javascript
0.0 %
0
image
0.0 %
0
font
0.0 %
0
TOTAL
100%
2
Content size by domain
Domain
Percent
Size
jptrip.cc
100.0 %
1.68 Kb
TOTAL
100%
1.68 Kb
Requests by domain
Domain
Percent
Requests
jptrip.cc
100.0 %
2
TOTAL
100%
2
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • It doesn't appear that this website is caching webpages. Cached pages serve up static html and avoid potentially time consuming queries to your database. It also helps lower server load by up to 80%. Caching most visibly benefits high traffic pages that access a database, but whose content does not change on every page view. Common caching methods include Alternative PHP Cache, Quickcache, and WP Super Cache (for Wordpress sites). Caching mechanisms also typically compress HTML, further reducing page size and load time.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test97% of top 100 sites passed
  • This webpage is not using images, javascript or css resources from same domain!
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using image resources!
Image Caching Test97% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test96% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test96% of top 100 sites passed
  • This webpage is not using JavaScript resources from the same domain.
See results list
CSS Minification Test100% of top 100 sites passed
  • This webpage is not using CSS resources from the same domain.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is not using render-blocking resources.
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage doesn't have a doctype declaration and this may cause rendering problems!
URL Redirects Test98% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.695 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.695 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 0.787 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

0.787 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 0.82 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

0.82 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: This XML file does not appear to have any style information associated with it. ...
Html: <div class="header">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0000. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.
0
Server and security
Score: 79
Failed: 2
Warnings: 0
Passed: 8
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.jptrip.cc" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
jptrip.cc
Subject Alternative Names (SANs)
jptrip.cc, *.jptrip.cc
Not valid before
Fri, January 17o 2025, 12:17:49 am (z)
Not valid after
Thu, April 17o 2025, 1:15:06 am (z)
Signature algorithm
ecdsaWithSha256
Issuer
WE1
Intermediate certificate
Common name
WE1
Organization
Google Trust Services
Location
US
Not valid before
Wed, December 13o 2023, 9:00:00 am (z)
Not valid after
Tue, February 20o 2029, 2:00:00 pm (z)
Signature algorithm
ecdsaWithSha384
Issuer
GTS Root R4
Root certificate
Common name
GTS Root R4
Organization
Google Trust Services LLC
Location
US
Not valid before
Wed, June 22o 2016, 12:00:00 am (z)
Not valid after
Sun, June 22o 2036, 12:00:00 am (z)
Signature algorithm
ecdsaWithSha384
Issuer
GTS Root R4
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test82% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test98% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test100% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 0
Failed: 2
Warnings: 0
Passed: 1
Meta Viewport Test88% of top 100 sites passed
  • This webpage does not have a viewport meta tag! Add a viewport meta tag to optimize your webpage for mobile screens.
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is not using CSS media queries. We recommend the use of this technique in order to implement responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 37
Failed: 2
Warnings: 1
Passed: 7
Structured Data Test53% of top 100 sites passed
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:_spf.mx.cloudflare.net ~all
Ads.txt Validation Test68% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved