seo site checkup logo
PricingFree ToolsArticles
Report generated 8 years ago
http://www.jlmorison.com/shop
Your general SEO Checkup Score
Archived
86/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 86 out of 100, which is higher than the average score of 75. Our analysis has identified 5 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
5 Failed
2 Warnings
34 Passed
Common SEO issues
Score: 75
Failed: 2
Warnings: 1
Passed: 12
Google Search Results Preview
Desktop version
https://www.jlmorison.com/shop/Online Shopping India: Baby Care, Body Care, Hair Care, Oral Care at JL MorisonMorisons Baby Dreams is a baby care brand, from the trusted house of J L Morison, which is successfully serving moms-to-be and new moms for more than 30 years now. The Morisons Baby Dreams online shop is designed keeping in mind a today’s mom. A mum loves her baby, likes her job and homework. As a multi tasker, she enjoys joy of parenting and delivers her responsibility on job and at home. Therefore, Morisons Baby Dreams has thoughtfully designed baby products that help every mum to traverse through her motherhood journey smoothly & smartly. That’s why, ‘She is a smart mum when she is a Morisons mum’. Morisons Baby Dreams brings to you a wide range of products that include feeding, hygiene, sippers, teethers & toys, mommy needs, apparel, bedding, gifting and baby gear. Every single product is manufactured under stringent hygiene conditions and conforms to highest quality standards. So, now discover premium baby products at Morisons Baby Dreams. Apart from making a mother’s journey easy and smart, we also truly understand her desire to provide her baby with nothing, but the best, even if it’s about the minutest thing. A mother starts planning everything even before the baby arrives. Such is the care and love of a mother for her newborn. From breastfeeding to baby care products, bathing essentials to right furniture, a mom wants to provide the best to her infant. With so much to do, a mum has no time to run around to buy the best all the time. Hence this one-stop online shopping portal serves you everything you need for your bundle of joy! From nursing bibs to onesies, nursing bottles to diapers, baby towels to romper suits and nappy, our myriad baby products will make every mum’s life easier and comfortable, of course, without compromising on quality and safety. What’s more, cute designs for both baby boy and baby girl. With more than 700+ baby products & 2.5 million smiles, we assure you that you will have an absolutely unrivaled shopping experience at Morisons Baby Dreams.
Mobile version
https://www.jlmorison.com/shop/Online Shopping India: Baby Care, Body Care, Hair Care, Oral Care at JL MorisonMorisons Baby Dreams is a baby care brand, from the trusted house of J L Morison, which is successfully serving moms-to-be and new moms for more than 30 years now. The Morisons Baby Dreams online shop is designed keeping in mind a today’s mom. A mum loves her baby, likes her job and homework. As a multi tasker, she enjoys joy of parenting and delivers her responsibility on job and at home. Therefore, Morisons Baby Dreams has thoughtfully designed baby products that help every mum to traverse through her motherhood journey smoothly & smartly. That’s why, ‘She is a smart mum when she is a Morisons mum’. Morisons Baby Dreams brings to you a wide range of products that include feeding, hygiene, sippers, teethers & toys, mommy needs, apparel, bedding, gifting and baby gear. Every single product is manufactured under stringent hygiene conditions and conforms to highest quality standards. So, now discover premium baby products at Morisons Baby Dreams. Apart from making a mother’s journey easy and smart, we also truly understand her desire to provide her baby with nothing, but the best, even if it’s about the minutest thing. A mother starts planning everything even before the baby arrives. Such is the care and love of a mother for her newborn. From breastfeeding to baby care products, bathing essentials to right furniture, a mom wants to provide the best to her infant. With so much to do, a mum has no time to run around to buy the best all the time. Hence this one-stop online shopping portal serves you everything you need for your bundle of joy! From nursing bibs to onesies, nursing bottles to diapers, baby towels to romper suits and nappy, our myriad baby products will make every mum’s life easier and comfortable, of course, without compromising on quality and safety. What’s more, cute designs for both baby boy and baby girl. With more than 700+ baby products & 2.5 million smiles, we assure you that you will have an absolutely unrivaled shopping experience at Morisons Baby Dreams.
Keywords Cloud
animalbabybathbeddingbestbibsbigenbodybootiesbottlebreastbrushbuddycarecarrycartclassiccleaningclothingcolorcombocomfortcoolcorporatecutiedesigneddreamseasyexcellentfacefeedinggeargiftgiftinggoldgroominghairhalfhandlehealthhelphygienekidsliquidlovelovesmindmommymonthsmorisonmorisonsmosquitonaturalneckneedsnursingonesiesonlineoraloralcareorderspackpastpearpillowpillowspolicypowderpremiumpriceproductproductsprovidepumpqualityregularrompersavesearchsetsshinyshippingshoesshoppingsippersippersskinsleevesslimsmartspeedyteddyteethertimetoothtoysusingviewyearyellow
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! We've found 1 sitemap file for your website:
SEO Friendly URL Test
  • We have found one URL that is not SEO friendly!
See results list
Image Alt Test
  • Your webpage has 37 'img' tags and 8 of them are missing the required 'alt' attribute.
See full list
Inline CSS Test
  • Your webpage is using 10 inline CSS styles!
See results list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your website is using the latest version of Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your web page.
Social Media Check
  • Congratulations! Your website is connected successfully with social media using: Facebook; Twitter;
Speed optimizations
Score: 89
Failed: 2
Warnings: 1
Passed: 8
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your page is successfully compressed using gzip compression on your code.
    Your HTML is compressed from 69.92 Kb to 13.22 Kb (81 % size savings). This helps ensure a faster loading web page and improved user experience.
Site Loading Speed Test
  • Your site loading time is around 3.057 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 78
  • 17 HTML Pages
  • 4 CSS Files
  • 15 JS Files
  • 42 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Your site is not using expires headers for your images. An expires tag can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Checker
  • Your URL performed 2 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 0
Failed: 1
Warnings: 0
Passed: 4
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
Server: Apache/2.4.10 (Debian)
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 100
Failed: 0
Warnings: 0
Passed: 7
Microdata Schema Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your page is using the canonical link tag. This tag specifies that the URL: https://www.jlmorison.com/shop is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link rel='canonical' href='https://www.jlmorison.com/shop/' />
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF Records Checker
  • Congratulations! Your DNS server is using an SPF record. This SPF record is listed below:
v=spf1 include:spf.mandrillapp.com include:netcore.co.in -all
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved