seo site checkup logo
PricingFree ToolsArticles
Report generated 6 years ago
https://www.jaipurgem.com/en
Your general SEO Checkup Score
Archived
80/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 80 out of 100, which is higher than the average score of 75. Our analysis has identified 8 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
8 Failed
3 Warnings
42 Passed
Common SEO issues
Score: 77
Failed: 3
Warnings: 1
Passed: 17
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: Jaipur Gem - One Stop Shop for All Your Gemstone Needs
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: Jaipurgem.com deals in all type of precious & semi-precious gemstones i.e Diamonds, Emeralds, Sapphire, Hessonite, Pearl, Moonstone, Amethyst, Citrine, Topaz, Tourmaline, Tanzanite, Opal, Peridot, Turquoise, Garnet, Quartz, Sunstone, Rubellite, Agate, Jasper, Labradorite & etc.
Google Search Results Preview Test
Desktop version
https://www.jaipurgem.com/enJaipur Gem - One Stop Shop for All Your Gemstone NeedsJaipurgem.com deals in all type of precious & semi-precious gemstones i.e Diamonds, Emeralds, Sapphire, Hessonite, Pearl, Moonstone, Amethyst, Citrine, Topaz, Tourmaline, Tanzanite, Opal, Peridot, Turquoise, Garnet, Quartz, Sunstone, Rubellite, Agate, Jasper, Labradorite & etc.
Mobile version
https://www.jaipurgem.com/enJaipur Gem - One Stop Shop for All Your Gemstone NeedsJaipurgem.com deals in all type of precious & semi-precious gemstones i.e Diamonds, Emeralds, Sapphire, Hessonite, Pearl, Moonstone, Amethyst, Citrine, Topaz, Tourmaline, Tanzanite, Opal, Peridot, Turquoise, Garnet, Quartz, Sunstone, Rubellite, Agate, Jasper, Labradorite & etc.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
8precious8stones7beads5gemstones4semi
Keywords Usage Test
  • Your most common keywords are not appearing in one or more of the meta-tags above. Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines.
Keyword(s) not included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
accountaquamarineartifactsartificialaskedbanglesbeadsbestsellersbluebraceletsbroochescartcarvedcatalogcategorieschampagnechipscitrineconditionscontactcookiescushiondarkdiamonddoubletsearringsemeraldfancyfeaturedfinefrequentlygarnetgemstonegemstonesgomedheerahessonitehomeinformationitemsjewellerylinemalachitemanakmanikmarquisemoonstonemorganitemotimultinecklacesneelamnewsletternoticeoffersopalpannapearpearlpendantsperidotpinkpolicypreciousprivacyproductspukhrajqualityquestionsrashiratnaregisterreturnrhodoliteringringsroughroundrubysalesapphiresemiservicessetsshippingshoppingsignsilverstatementstonesstuddedsynthetictopaztourmalinetripletsturquoisewaitwhitewishlistyellow
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your webpage does not contain any H1 headings. H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
AQUAMARINE
GARNET
MALACHITE
MOONSTONE
MORGANITE
OPAL
TOURMALINE
TURQUOISE
SKY BLUE TOPAZ & CZ STUDDED SILVER STATEMENT RING
CHAMPAGNE TOPAZ CUT CUSHION 12MM 8.62 Cts.
RHODOLITE CUT PEAR (PINK) (HI) 15X10MM 6.90 Cts.
MULTI TOURMALINE 4.00-6.00MM CHIPS PER 34-35" LINE
PERIDOT CUT ROUND (TOP) 2MM 0.04 Cts.
CITRINE CUT ROUND (YELLOW) 2MM 0.03 Cts.
DARK RED GARNET CUT MARQUISE 6X3MM 0.28 Cts.
WHITE AQUAMARINE CUT ROUND 2.50MM 0.05 Cts
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Social Media Test
  • Congratulations! Your website is connected successfully with social media using:
Facebook Pinterest 
Speed optimizations
Score: 74
Failed: 3
Warnings: 1
Passed: 12
HTML Page Size Test
  • Congratulations! The size of your webpage's HTML is 8.17 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 45.31 Kb to 8.17 Kb (82% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 4.5 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Total Objects: 51
  • 2 HTML Pages
  • 5 CSS Files
  • 9 JS Files
  • 35 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Image Caching Test
  • Congratulations! Your website is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Caching Test
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test
  • Congratulations! Your website is using cache headers for all CSS resources.
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Some of your webpage's CSS resources are not minified.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 80
Failed: 1
Warnings: 1
Passed: 4
URL Canonicalization Test
HTTPS Test
  • Your website is successfully using the HTTPS protocol, but the SSL Certificate will expire in less than a month! Having an up-to-date certificate is an important security practice to ensure that your website is safe and provides trust, and any communication between the user's browser and your website (such as passwords, credit cards, or forms) is encrypted and private.
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
Server: Microsoft-IIS/8.0
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 89
Failed: 1
Warnings: 0
Passed: 7
Structured Data Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Custom 404 Error Page Test
  • Congratulations, your website is using a custom 404 error page. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage does not use the canonical link tag.
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF Records Test
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 +a +mx +ip4:96.127.185.122 ~all
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved