seo site checkup logo
PricingFree ToolsArticles
Report generated 2 years ago
https://www.interad.com/en
Your general SEO Checkup Score
Archived
91/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 91 out of 100, which is higher than the average score of 75. Our analysis has identified 6 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
6 Failed
3 Warnings
62 Passed
Issues to fix
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
Common SEO issues
Score: 90
Failed: 2
Warnings: 1
Passed: 22
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Digital Marketing in Korea - PPC & SEO Company - InterAd©
Length: 57 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 149 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Want to localize your business in Korea? InterAd Provide Digital Marketing Services in the Main Korean Platforms ✓ Naver SEO ✓ Naver Ads ✓ KakaoTalk.
Length: 149 characters
Google Search Results Preview Test
Desktop version
https://www.interad.com/en/Digital Marketing in Korea - PPC & SEO Company - InterAd©Want to localize your business in Korea? InterAd Provide Digital Marketing Services in the Main Korean Platforms ✓ Naver SEO ✓ Naver Ads ✓ KakaoTalk.
Mobile version
https://www.interad.com/en/Digital Marketing in Korea - PPC & SEO Company - InterAd©Want to localize your business in Korea? InterAd Provide Digital Marketing Services in the Main Korean Platforms ✓ Naver SEO ✓ Naver Ads ✓ KakaoTalk.
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_US
og:locale:alternate
ko_KR
og:type
website
og:title
Digital Marketing in Korea - PPC & SEO Company - InterAd©
og:description
Want to localize your business in Korea? InterAd Provide Digital Marketing Services in the Main Korean Platforms ✓ Naver SEO ✓ Naver Ads ✓ KakaoTalk.
og:url
https://www.interad.com/en/
og:site_name
InterAd
og:image
https://www.interad.com/resources/uploads/2023/04/global-digital-marketing-agency_og_600x315.webp
og:image:width
600
og:image:height
315
og:image:type
image/webp
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
22naver19marketing11korean11case10korea
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
naver
marketing
korean
case
korea
Keywords Cloud Test
advertisingagencyarticlearticlesasianaudienceblogblogsbuildbusinesscalmcampaignscasechinaclientscodecommercecompanycompleteconsumercontactcontentcookiecookiescountrycoupangdigitalengineenginesethicsexpandexpertsexplorefacebookfaqsfollowfollowedglobalgooglegrowguidehavehealthcarehelpedincreaseinsightsinstagraminteradinternetkakaokoreakoreanlaunchmainmanagementmarketmarketingmediamorningnavernecessaryonlineorganicpaidpartyplatformplatformspopularpreferredpresenceprovidesprovidingrankingrapidlyreadreadyrequiredsalessearchseoulserviceservicesshareskipsocialsouthstorystrategiesstudiesstudyteamthankstrademarkstraffictrendstwitteruserswantyearsyoutube
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Digital Marketing in Korea
H2 tags
Over 21 Years Providing SEM and SEO Services
Korean SEO
Naver Ads
Social Media Marketing
Influencer Marketing
The PPC and SEO Agency of Choice for over 500 Companies
Case Studies
Search Engine Expertise SEO Company
Popular Articles
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • This website has a sitemap file.
SEO Friendly URL Test40% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test80% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 88
Failed: 3
Warnings: 1
Passed: 19
HTML Page Size Test34% of top 100 sites passed
  • The size of this webpage's HTML is 15.68 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,526 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 84.08 Kb to 15.68 Kb (81% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 2.48 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
76.5 %
540.88 Kb
javascript
14.5 %
102.26 Kb
other
5.4 %
38.08 Kb
html
2.2 %
15.48 Kb
css
1.4 %
10.14 Kb
font
0.0 %
0 B
TOTAL
100%
706.84 Kb
Requests by content type
Content type
Percent
Requests
image
66.7 %
30
other
13.3 %
6
css
8.9 %
4
javascript
8.9 %
4
html
2.2 %
1
font
0.0 %
0
TOTAL
100%
45
Content size by domain
Domain
Percent
Size
interad.com
85.1 %
601.32 Kb
googletagmanager.com
13.9 %
98.07 Kb
cdnjs.cloudflare.com
0.7 %
4.76 Kb
googleads.g.doubleclick.net
0.3 %
1.84 Kb
google.com
0.1 %
456 B
analytics.google.com
0.0 %
211 B
stats.g.doubleclick.net
0.0 %
211 B
TOTAL
100%
706.84 Kb
Requests by domain
Domain
Percent
Requests
interad.com
86.7 %
39
cdnjs.cloudflare.com
2.2 %
1
googletagmanager.com
2.2 %
1
analytics.google.com
2.2 %
1
stats.g.doubleclick.net
2.2 %
1
googleads.g.doubleclick.net
2.2 %
1
google.com
2.2 %
1
TOTAL
100%
45
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test
  • This webpage is not using images with large metadata.
Image Caching Test99% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 1.44 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.44 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Digital Marketing in Korea Ready to expand your business to the Korean market? ...
Html: <div class="masthead contras m-0 " style="background: linear-gradient(rgba(0, 0, 0, 0.25), r...">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.0. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.0004

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Services About Us Insights Case Studies English 한국어 Contact Us
Html: <div class="wp-block-group e-hid is-content-justification-righ..." style="padding-right:0;padding-left:0">
Score: 0.0002
Server and security
Score: 100
Failed: 0
Warnings: 0
Passed: 10
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.interad.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
interad.com
Subject Alternative Names (SANs)
interad.com, *.interad.com
Not valid before
Tue, June 13o 2023, 1:21:38 pm (z)
Not valid after
Mon, September 11o 2023, 1:21:37 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GTS CA 1P5
Intermediate certificate
Common name
GTS CA 1P5
Organization
Google Trust Services LLC
Location
US
Not valid before
Thu, August 13o 2020, 12:00:42 am (z)
Not valid after
Thu, September 30o 2027, 12:00:42 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GTS Root R1
Root certificate
Common name
GTS Root R1
Organization
Google Trust Services LLC
Location
US
Not valid before
Wed, June 22o 2016, 12:00:00 am (z)
Not valid after
Sun, June 22o 2036, 12:00:00 am (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
GTS Root R1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000; includesubdomains; preload
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 90
Failed: 1
Warnings: 1
Passed: 8
Structured Data Test59% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.interad.com/en/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.interad.com/en/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved