seo site checkup logo
PricingFree ToolsArticles
Report generated 3 hours ago
https://www.honda-kusuma.co.id
Your general SEO Checkup Score
Archived
48/100
SEO Score
Average SEO score of top 100 sites: 75%
Unfortunately, this webpage received an SEO score of 48 out of 100, which is significantly lower than the average score of 75. Our analysis has identified 24 SEO issues that need to be addressed urgently to improve your website's performance and avoid further damage to your search engine visibility.
24 Failed
5 Warnings
32 Passed
Issues to fix
HIGH
To provide a good user experience, Google recommends that sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.
HIGH
To address URL canonicalization issues, it is recommended to select a primary URL for your webpage and set up redirects from all other variations to the preferred one.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Add a sitemap file to help search engine crawlers index content more thoroughly and quickly.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a First Contentful Paint value of 1.8 seconds or less.
MEDIUM
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
MEDIUM
Consider adding cache headers for JavaScript resources to speed up the webpage for returning users.
MEDIUM
Consider adding cache headers for images to improve website performance. With cache headers, browsers can cache images and serve them quickly to returning visitors, rather than re-fetching them each time.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
MEDIUM
Consider adding cache headers for CSS resources to speed up the webpage for returning users.
MEDIUM
Using social media meta tags can improve the appearance and content of shared links on social media platforms, potentially increasing click-through rates and engagement with the page.
MEDIUM
HTTP/2 protocol offers several key improvements, including faster page load times, improved performance, better security and more efficient use of network resources.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Consider reducing the HTML size to improve loading times and retain visitors.
LOW
Enable HTML compression to reduce page size and loading times.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
LOW
This website either lacks a favicon or it has not been referenced properly.
Common SEO issues
Score: 56
Failed: 7
Warnings: 2
Passed: 13
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Honda Kusuma Semarang
Length: 21 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 227 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Honda Kusuma Semarang adalah dealer resmi Honda yang telah melayani masyarakat Semarang dan sekitarnya. Melayani penjualan mobil Honda baru, layanan purna jual, penyediaan suku cadang asli, hingga perbaikan bodi kendaraan.
Length: 227 characters
Google Search Results Preview Test
Desktop version
https://www.honda-kusuma.co.id/Honda Kusuma SemarangHonda Kusuma Semarang adalah dealer resmi Honda yang telah melayani masyarakat Semarang dan sekitarnya. Melayani penjualan mobil Honda baru, layanan purna jual, penyediaan suku cadang asli, hingga perbaikan bodi kendaraan.
Mobile version
https://www.honda-kusuma.co.id/Honda Kusuma SemarangHonda Kusuma Semarang adalah dealer resmi Honda yang telah melayani masyarakat Semarang dan sekitarnya. Melayani penjualan mobil Honda baru, layanan purna jual, penyediaan suku cadang asli, hingga perbaikan bodi kendaraan.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
19spesifikasi18mulai18dari18harga10honda
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
spesifikasi
mulai
dari
harga
honda
Keywords Cloud Test
adalahandaarticleasliatauaturbagibarubatalkanberbagaiberpengalamanberubahbodibodybookbookingcadangcareerdapatdapatkandaridealerdengandioperasikanfiturgeneralhargahinggahomehondahybridindahistanajadwalkanjawajualjulikamikebutuhankendaraankirimkunjungikusumalayananlengkapmasyarakatmaterialmelayanimemberikanmenarikmenjadimenumenyediakanmobilmotormulainovemberolehotomotifpecintapemberitahuanpenjualanpenyediaanperbaikanpermintaanpertamapilihanproductprofesionalpromopromotionpurnarepairresmisalessebagaisejaksekarangsekitarnyasemarangservicesewaktusiapsolusisparespesifikasisukutanpatelahtengahtentangtepatterbaikterpercayaterpopuleruntukutamawaktuwilayahyang
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Tentang Honda Kusuma Semarang
Dealer Resmi Honda Terpercaya di Semarang Sejak 1988
Mobil Hybrid Terpopuler
H2 tags
Menu
PILIHAN YANG TERSEDIA
HARGA MULAI DARI
Rp 655.500.000
Rp 462.000.000
Rp 1.005.000.000
Rp 724.900.000
Rp 781.700.000
Rp 396.050.000
Rp 408.250.000
Rp 290.250.000
Rp 655.500.000
Rp 462.000.000
Rp 1.005.000.000
Rp 724.900.000
Rp 781.700.000
Rp 396.050.000
Rp 408.250.000
Rp 290.250.000
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website lacks a sitemap file! Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Image Alt Test78% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • This website either doesn't have a favicon or this has not been referenced correctly!
JS Error Test83% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test27% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 35
Failed: 11
Warnings: 2
Passed: 7
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 559 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage doesn't use HTML compression! We recommend to compress the HTML code in order to reduce the page size and page loading times - this will help a website to retain visitors and increase page views. If the HTML compression will be enabled, the HTML size will be decreased by 84% - from 79.7 Kb to 12.51 Kb .
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 12.95 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
86.1 %
8.21 Mb
javascript
6.1 %
597.88 Kb
font
5.3 %
516.23 Kb
css
1.7 %
163.33 Kb
html
0.9 %
83.30 Kb
other
0.0 %
43 B
TOTAL
100%
9.54 Mb
Requests by content type
Content type
Percent
Requests
image
63.0 %
46
javascript
23.3 %
17
css
6.8 %
5
html
2.7 %
2
font
2.7 %
2
other
1.4 %
1
TOTAL
100%
73
Content size by domain
Domain
Percent
Size
honda-kusuma.co.id
95.8 %
9.14 Mb
maps.googleapis.com
3.2 %
311.86 Kb
maps.gstatic.com
0.6 %
59.58 Kb
cdn.jsdelivr.net
0.4 %
35.60 Kb
google.com
0.0 %
1.90 Kb
TOTAL
100%
9.54 Mb
Requests by domain
Domain
Percent
Requests
honda-kusuma.co.id
76.7 %
56
maps.googleapis.com
16.4 %
12
cdn.jsdelivr.net
4.1 %
3
google.com
1.4 %
1
maps.gstatic.com
1.4 %
1
TOTAL
100%
73
CDN Usage Test95% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
See results list
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is not using cache headers for JavaScript resources! Setting cache headers can help to speed up the webpage for returning users.
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using cache headers for CSS resources! Setting cache headers can help to speed up the webpage for returning users.
See results list
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.524 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.524 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 3.240 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

3.24 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 5.24 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

5.24 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img src="/storage/image/banner/promo-hot-deal-oktober-2025-..." class="image" alt="Promo Hot Deal Oktober 2025">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.2234. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.2234

0.1

0.25

DOM element which contributes the most to CLS score:
Text: BOOK YOUR CAR BOOK SERVICE KIRIM PERMINTAAN Tentang Honda Kusuma Semarang Deale...
Html: <div class="w-full h-max bg-[#EDEEF2]">
Score: 0.2234
Server and security
Score: 47
Failed: 4
Warnings: 0
Passed: 3
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.honda-kusuma.co.id" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.honda-kusuma.co.id
Subject Alternative Names (SANs)
*.honda-kusuma.co.id, honda-kusuma.co.id
Not valid before
Sat, September 20o 2025, 8:44:27 am (z)
Not valid after
Fri, December 19o 2025, 8:44:26 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R13
Intermediate certificate
Common name
R13
Organization
Let's Encrypt
Location
US
Not valid before
Wed, March 13o 2024, 12:00:00 am (z)
Not valid after
Fri, March 12o 2027, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is not using the HTTP/2 protocol!
HSTS Test84% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 45
Failed: 2
Warnings: 1
Passed: 6
Structured Data Test66% of top 100 sites passed
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 +a +mx +ip4:112.109.21.252 +ip4:112.109.21.49 +ip4:112.109.21.253 +ip4:112.109.21.113 +ip4:112.109.21.250 +ip4:203.89.24.35 +ip4:203.89.28.62 +include:_spf.google.com ~all
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved