seo site checkup logo
PricingFree ToolsArticles
Report generated 8 years ago
https://www.goodyear.eu/tr_tr/consumer
Your general SEO Checkup Score
Archived
74/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 74 out of 100, which is below the average score of 75. However, there are 8 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
8 Failed
2 Warnings
31 Passed
Common SEO issues
Score: 65
Failed: 3
Warnings: 0
Passed: 12
Google Search Results Preview
Desktop version
https://www.goodyear.eu/tr_tr/consumer.htmlLastik Fiyatları, Yaz Lastiği, Kış Lastiği, 4 Mevsim Lastik - Goodyear100 yılı aşkın bir inovasyon ve en son teknoloji ürünü olan Goodyear lastikleri en yüksek düzeyde performans ve güvenlik sağlar.
Mobile version
https://www.goodyear.eu/tr_tr/consumer.htmlLastik Fiyatları, Yaz Lastiği, Kış Lastiği, 4 Mevsim Lastik - Goodyear100 yılı aşkın bir inovasyon ve en son teknoloji ürünü olan Goodyear lastikleri en yüksek düzeyde performans ve güvenlik sağlar.
Keywords Cloud
adetakaryakitalanlaraalgılayabilenalmıştıraraçaraçlarındaasymmetricayrıntıbayibağımsızbilgibilgileribinekbirbirindenbirçokboyuncadahadetaylardeğildiĞerdönüştürendörteagleedenleretkileşimefarklıfazlafrengelengirebilengoodyeargoodyear’ıgÖregöstergüçlendirilerekhediyehikayeleriislakiÇiniçinjantkampanyasikapatkararkartkeyfinizkonseptkontrolkurukurumsalkısakışlastiklastiklerlastiklerilastiklerimizlastiğilastiğinimarkamarkasınımesafesinemevsimnasılolsunonlarınopetotomobilperformanssadecesahipsatınsatışseferdesitesitelerisizdesonucundatanımlamatanıttıtarihlerindetercihtestleritl’yetümvaranverenveyayakıtyardimyenİyerindeyetkiliyoldazemindeÖndeÜlkeyiÜreticileriödülüzeri
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Your site lacks a sitemap file. Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
SEO Friendly URL Test
  • We have found 70 URLs that are not SEO friendly!
See results list
Image Alt Test
  • Your webpage has 14 'img' tags and 9 of them are missing the required 'alt' attribute.
See full list
Inline CSS Test
  • Congratulations! Your web page does not use inline CSS styles.
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your website is using the latest version of Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your web page.
Social Media Check
Speed optimizations
Score: 60
Failed: 3
Warnings: 2
Passed: 6
HTML Page Size Test
HTML Compression/GZIP Test
  • Your page do not use any HTML compression!
    You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 80 % - from 37.08 Kb to 7.50 Kb which would further reduce your page loading time.
Site Loading Speed Test
  • Your site loading time is around 2.702 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 55
  • 16 HTML Pages
  • 2 CSS Files
  • 12 JS Files
  • 25 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Your site is not using expires headers for all of your images. An expires tag can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE &lt;!doctype html>
URL Redirects Checker
  • Your URL performed 2 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 86
Failed: 1
Warnings: 0
Passed: 5
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
Server: Apache/2.4.6 (Red Hat Enterprise Linux) Communique/4.2.0
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 80
Failed: 1
Warnings: 0
Passed: 5
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your page does not use the canonical link tag.
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
SPF records checker
  • Congratulations! Your DNS server is using an SPF record. This SPF record is listed below:
v=spf1 redirect=goodyear.com

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved