seo site checkup logo
PricingFree ToolsArticles
Report generated 2 years ago
https://glassdarklyphoto.com
Your general SEO Checkup Score
Archived
79/100
SEO Score
Average SEO score of top 100 sites: 74%
This website received an SEO score of 79 out of 100, which is higher than the average score of 74. Our analysis has identified 13 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
13 Failed
4 Warnings
52 Passed
Common SEO issues
Score: 78
Failed: 4
Warnings: 2
Passed: 20
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 65 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Los Angeles Photography - Professional & Experienced Photographer
Length: 65 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Capture yourself with the innovative photography from Glass Darkly. Our Los Angeles photography is performed by a professional and experienced photographer. Book your photography session today!
Length: 193 characters
Google Search Results Preview Test
Desktop version
https://glassdarklyphoto.comLos Angeles Photography - Professional & Experienced PhotographerCapture yourself with the innovative photography from Glass Darkly. Our Los Angeles photography is performed by a professional and experienced photographer. Book your photography session today!
Mobile version
https://glassdarklyphoto.comLos Angeles Photography - Professional & Experienced PhotographerCapture yourself with the innovative photography from Glass Darkly. Our Los Angeles photography is performed by a professional and experienced photographer. Book your photography session today!
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:image
https://static.showit.co/1200/KDo3YXSFQlODfP-M7obdww/87187/wide.jpg
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
15glass15darkly14angeles13photographer8family
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
glass
darkly
angeles
photographer
family
Keywords Cloud Test
actorsamazingandreaangelesbeautifulbeautybestblogbookbreathtakingbrigettebringcapturecapturedcitycomecomfortablecontactcouldndarklyemmyengagementsexperienceexperiencedexploreexquisitefacefamilyfeelferminfilmsgallerygettingglassglassdarklyphotogmailgoesgreathaveheadshotshelphollywoodhomeimagesinnerjaylinkindknowlifelikelittlelocationlookinglovemainmakemarkmaternitymomentsneednewbornnorthpagepasadenaperfectphotographerphotographyphotosphotoshootpicturesportfolioportraitportraitspricingprofessionalquitereallyrecommendsallyscottscrollsessionsessionsshootshootsshotssitemapstorystylestylingtestimonialstimetruetrulyuniqueviewweddingweddingswifework
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Exquisite Los Angeles Photography
H2 tags
I Am Your Professional And Experienced Photographer in LA
Your Collaborative Los Angeles Photography
Your Friendly, Experienced Los Angeles Photographer
Robots.txt Test94% of top 100 sites passed
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test75% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test40% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test33% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html;charset=UTF-8
Social Media Test80% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 78
Failed: 5
Warnings: 1
Passed: 17
HTML Page Size Test34% of top 100 sites passed
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,427 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 329.26 Kb to 37.05 Kb (89% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 1.26 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
91.6 %
3.37 Mb
javascript
5.5 %
205.28 Kb
font
1.8 %
68.17 Kb
html
1.0 %
35.80 Kb
css
0.2 %
7.55 Kb
other
0.0 %
36 B
TOTAL
100%
3.68 Mb
Requests by content type
Content type
Percent
Requests
image
54.5 %
18
javascript
18.2 %
6
css
9.1 %
3
font
9.1 %
3
other
6.1 %
2
html
3.0 %
1
TOTAL
100%
33
Content size by domain
Domain
Percent
Size
static.showit.co
92.7 %
3.41 Mb
googletagmanager.com
3.2 %
118.91 Kb
lib.showit.co
1.0 %
37.98 Kb
glassdarklyphoto.com
1.0 %
35.80 Kb
ajax.googleapis.com
0.8 %
31.00 Kb
google-analytics.com
0.5 %
19.96 Kb
fonts.gstatic.com
0.4 %
14.17 Kb
res.cloudinary.com
0.3 %
10.60 Kb
cdnjs.cloudflare.com
0.1 %
3.85 Kb
fonts.googleapis.com
0.0 %
1.17 Kb
TOTAL
100%
3.68 Mb
Requests by domain
Domain
Percent
Requests
static.showit.co
57.6 %
19
lib.showit.co
9.1 %
3
google-analytics.com
9.1 %
3
googletagmanager.com
6.1 %
2
glassdarklyphoto.com
3.0 %
1
fonts.googleapis.com
3.0 %
1
cdnjs.cloudflare.com
3.0 %
1
ajax.googleapis.com
3.0 %
1
res.cloudinary.com
3.0 %
1
fonts.gstatic.com
3.0 %
1
TOTAL
100%
33
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test99% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 0.0 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.
0
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.
0
Server and security
Score: 89
Failed: 2
Warnings: 0
Passed: 7
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "glassdarklyphoto.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
glassdarklyphoto.com
Subject Alternative Names (SANs)
glassdarklyphoto.com, www.glassdarklyphoto.com
Not valid before
Fri, August 26o 2022, 10:34:35 am (z)
Not valid after
Thu, November 24o 2022, 10:34:34 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R3
Intermediate certificate
Common name
R3
Organization
Let's Encrypt
Location
US
Not valid before
Fri, September 4o 2020, 12:00:00 am (z)
Not valid after
Mon, September 15o 2025, 4:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • We've found 2 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 50
Failed: 1
Warnings: 0
Passed: 2
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is not using CSS media queries. We recommend the use of this technique in order to implement responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 85
Failed: 1
Warnings: 1
Passed: 6
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://glassdarklyphoto.com is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://glassdarklyphoto.com" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2024 • All rights reserved