seo site checkup logo
PricingFree ToolsArticles
Report generated 2 days ago
https://www.frankfurtlimo.de
Your general SEO Checkup Score
Archived
74/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 74 out of 100, which is below the average score of 75. However, there are 10 SEO issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
10 Failed
7 Warnings
44 Passed
Issues to fix
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
To implement responsive design functionalities, it is recommended to use CSS media queries.
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
This website either lacks a favicon or it has not been referenced properly.
Common SEO issues
Score: 66
Failed: 5
Warnings: 2
Passed: 15
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Frankfurt Limo | Quality VIP transfer
Length: 37 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 35 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: This is the homepage of the website
Length: 35 characters
Google Search Results Preview Test
Desktop version
https://www.frankfurtlimo.de/enFrankfurt Limo | Quality VIP transferThis is the homepage of the website
Mobile version
https://www.frankfurtlimo.de/enFrankfurt Limo | Quality VIP transferThis is the homepage of the website
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:type
website
og:title
Frankfurt Limo | Quality VIP transfer
og:site_name
Frankfurt Limo | Quality VIP transfer
og:url
https://www.frankfurtlimo.de/en
og:image
https://www.frankfurtlimo.de/web/image/website/1/logo?unique=b5e7519
og:description
This is the homepage of the website
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
6vehicles6service5english4safe4professional
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
vehicles
service
english
safe
professional
Keywords Cloud Test
affordableairportappointmentbernadottestrbestbrowsebudgetbusinesschauffeurchoosecitycomfortcomfortablecontactcontactfrankfurtlimocontentcopyrightdeutschdrivendriversecommerceenglishequippedexperiencedexpertfeelfleetfollowfrankfurtfrankfurtlimofriendlyguaranteedhavehighhighesthomeinsuredjourneylearnluxurymaintainedmakemeticulouslymodelsneedsoccasionsofferopenpoweredpreparedpriceprioritiespriorityprofessionalprovidequalityregularlyreservationreservedreviewsafeserviceservicesskipsourcespecialsuitssupportteamthoughttimetimelytransfertransferstransportationtraveltripstürkçevaluevehiclevehicleswhatsapp
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
Browse Our Fleet!
Our priorities;
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • This website either doesn't have a favicon or this has not been referenced correctly!
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Speed optimizations
Score: 80
Failed: 2
Warnings: 4
Passed: 14
HTML Page Size Test23% of top 100 sites passed
  • The size of this webpage's HTML is 7.03 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 227 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using zstd compression on your code. The HTML code is compressed from 30.24 Kb to 7.03 Kb (77% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 2.88 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage has less than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from the server, which will ultimately slow down the loading of your webpage.
Content size by content type
Content type
Percent
Size
html
46.1 %
8.74 Kb
javascript
41.5 %
7.87 Kb
image
7.3 %
1.38 Kb
other
5.1 %
997 B
css
0.0 %
0 B
font
0.0 %
0 B
TOTAL
100%
18.97 Kb
Requests by content type
Content type
Percent
Requests
html
50.0 %
5
javascript
20.0 %
2
other
20.0 %
2
image
10.0 %
1
css
0.0 %
0
font
0.0 %
0
TOTAL
100%
10
Content size by domain
Domain
Percent
Size
frankfurtlimo.de
58.5 %
11.10 Kb
static.cloudflareinsights.com
36.5 %
6.93 Kb
download.odoo.com
5.0 %
964 B
TOTAL
100%
18.97 Kb
Requests by domain
Domain
Percent
Requests
frankfurtlimo.de
80.0 %
8
download.odoo.com
10.0 %
1
static.cloudflareinsights.com
10.0 %
1
TOTAL
100%
10
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • This webpage is not using CSS resources from the same domain.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test97% of top 100 sites passed
  • This URL performed 2 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.941 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.941 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 2.812 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

2.812 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 2.81 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

2.81 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Each of our vehicles is meticulously prepared by our professional drivers and eq...
Html:

Each of our vehicles is meticulously prepared by our professional drivers and equipped to provide the highest comfort throughout your journey. You can review the vehicle models we offer and choose

Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0223. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0223

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Safe and quality service Safe and comfortable transportation with luxury vehicl...
Html: <main>
Score: 0.0223
Server and security
Score: 89
Failed: 1
Warnings: 0
Passed: 6
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.frankfurtlimo.de" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
frankfurtlimo.de
Subject Alternative Names (SANs)
frankfurtlimo.de, *.frankfurtlimo.de
Not valid before
Wed, December 10o 2025, 6:04:10 pm (z)
Not valid after
Tue, March 10o 2026, 7:02:45 pm (z)
Signature algorithm
ecdsaWithSha256
Issuer
WE1
Root certificate
Common name
WE1
Organization
Google Trust Services
Location
US
Not valid before
Wed, December 13o 2023, 9:00:00 am (z)
Not valid after
Tue, February 20o 2029, 2:00:00 pm (z)
Signature algorithm
ecdsaWithSha384
Issuer
GTS Root R4
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000; includesubdomains
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 29
Failed: 1
Warnings: 0
Passed: 2
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is not using CSS media queries. We recommend the use of this technique in order to implement responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 88
Failed: 1
Warnings: 1
Passed: 7
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.frankfurtlimo.de/en is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.frankfurtlimo.de/en" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved