seo site checkup logo
PricingFree ToolsArticles
Report generated 3 years ago
https://www.floweradvisor.co.id
Your general SEO Checkup Score
Archived
83/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 83 out of 100, which is higher than the average score of 75. Our analysis has identified 9 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
9 Failed
2 Warnings
48 Passed
Common SEO issues
Score: 69
Failed: 5
Warnings: 2
Passed: 16
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: Toko Bunga & Hadiah Online Indonesia | FlowerAdvisor
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: Toko Bunga & Hadiah Online Indonesia, kirim Bunga & Hadiah ke seluruh Indonesia & luar negeri pada hari yang sama. Kami Buka 24 Jam melayani pengiriman Anda.
Google Search Results Preview Test
Desktop version
https://www.floweradvisor.co.idToko Bunga & Hadiah Online Indonesia | FlowerAdvisorToko Bunga & Hadiah Online Indonesia, kirim Bunga & Hadiah ke seluruh Indonesia & luar negeri pada hari yang sama. Kami Buka 24 Jam melayani pengiriman Anda.
Mobile version
https://www.floweradvisor.co.idToko Bunga & Hadiah Online Indonesia | FlowerAdvisorToko Bunga & Hadiah Online Indonesia, kirim Bunga & Hadiah ke seluruh Indonesia & luar negeri pada hari yang sama. Kami Buka 24 Jam melayani pengiriman Anda.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
113bunga100valentine93hari60sekarang58vday
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
adalahakanandaanekaanniversaryataubabybearbeliberwarnabouquetbreathbuketbungacarnationcocokdalamdaridengandiberikanferrerofillersflowerfloweradvisorflowersgifthadiahhargahariheartimlekindonesiajenisjugakadokamikamukarangankarenakategorikelahirankepadakertaskualitaslebaranlebihloveluarmaafmakananmawarmemberikanmemperindahmenyediakanmerahnormaloccasionsornamenpadapapanparcelpengirimanperfectpermintaanpernikahanpesanpilihanpinkpitapremiumprodukrangkaianromantisroserosessaatsangatsebagaisekarangselamatsembuhsepertiserviceshopsimpatispecialtahuntambahantangkaiteddyterdiritokoucapanulanguntukvalentinevdaywhitewrappingyang
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your page contains too many H2 tags. H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Toko Bunga & Hadiah Online Indonesia
H2 tags
VDAY 2022 - Dreamy Heart - Hari Valentine
VDAY 2022 - I Heart You Lots - Hari Valentine
VDAY 2022 - Jar of Hearts - Hari Valentine
VDAY 2022 - Enchanting Belle - Hari Valentine
VDAY 2022 - Blissful Pink - Hari Valentine
VDAY 2022 - Thunderous Whisper - Hari Valentine
VDAY 2022 - Jacqueline - Hari Valentine
VDAY 2022 - Keep Being You - Hari Valentine
VDAY 2022 - Sweetie Poem - Hari Valentine
VDAY 2022 - Beauté - Hari Valentine
VDAY 2022 - Wonderland Bubble - Hari Valentine
VDAY 2022 - Wonderful Hugs - Hari Valentine
VDAY 2022 - Love On The Line - Hari Valentine
VDAY 2022 - Stuck with U - Hari Valentine
VDAY 2022 - Loving Whispers - Hari Valentine
VDAY 2022 - Cherry Lips - Hari Valentine
VDAY 2022 - Gisellia - Hari Valentine
VDAY 2022 - Flowers in Ocean - Hari Valentine
VDAY 2022 - Gracia - Hari Valentine
VDAY 2022 - Passion Pastel - Hari Valentine
VDAY 2022 - My Only Love Rose - Hari Valentine
VDAY 2022 - Ciao Bella - Hari Valentine
VDAY 2022 - Heart Warmth - Hari Valentine
VDAY 2022 - Love Angel - Hari Valentine
VDAY 2022 - Giving My Best - Hari Valentine
VDAY 2022 - Always Autumn - Hari Valentine
VDAY 2022 - Meredith - Hari Valentine
VDAY 2022 - Just A Dream - Hari Valentine
VDAY 2022 - Warmest Hearts - Hari Valentine
Toko Bunga Online Terlengkap dan Pengiriman Ke Seluruh Indonesia
Jenis Bunga dan Karangan Bunga Yang Tersedia
Menyambut Hari Raya Valentine
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
SEO Friendly URL Test
  • Your webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Responsive Image Test
  • Not all images in this page are properly sized! You are serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test
  • We found some HTML deprecated tags. You are advised to change these old tags with equivalent tags or proper CSS rules.
3font1u
Google Analytics Test
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Console Errors Test
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Social Media Test
  • Congratulations! Your website is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 100
Failed: 1
Warnings: 0
Passed: 15
HTML Page Size Test
  • Congratulations! The size of your webpage's HTML is 29.0 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using br compression on your code. Your HTML is compressed from 220.13 Kb to 29.0 Kb (87% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 4.93 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Content size by content type
Content type
Percent
Size
image
45.0 %
564.65 Kb
javascript
32.6 %
408.78 Kb
css
7.4 %
93.01 Kb
other
6.5 %
81.25 Kb
font
6.0 %
75.74 Kb
html
2.6 %
32.15 Kb
TOTAL
100%
1.23 Mb
Requests by content type
Content type
Percent
Requests
image
58.5 %
31
javascript
15.1 %
8
font
13.2 %
7
css
5.7 %
3
html
3.8 %
2
other
3.8 %
2
TOTAL
100%
53
Content size by domain
Domain
Percent
Size
img.floweradvisor.com
49.5 %
621.27 Kb
floweradvisor.co.id
34.6 %
434.15 Kb
connect.facebook.net
15.7 %
197.60 Kb
go.ecotrackings.com
0.2 %
2.08 Kb
facebook.com
0.0 %
493 B
TOTAL
100%
1.23 Mb
Requests by domain
Domain
Percent
Requests
img.floweradvisor.com
66.0 %
35
floweradvisor.co.id
20.8 %
11
connect.facebook.net
7.5 %
4
facebook.com
3.8 %
2
go.ecotrackings.com
1.9 %
1
TOTAL
100%
53
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test
  • Your webpage is serving all images, javascript and css resources from CDNs.
See results list
Image Caching Test
  • Congratulations! Your website is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Caching Test
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test
  • Congratulations! Your website is using cache headers for all CSS resources.
JavaScript Minification Test
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test
  • Congratulations! Your webpage's CSS resources are minified.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 94
Failed: 1
Warnings: 0
Passed: 7
URL Canonicalization Test
SSL Checker and HTTPS Test
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.floweradvisor.co.id" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
sni.cloudflaressl.com
Organization
Cloudflare, Inc.
Location
San Francisco, California, US
Subject Alternative Names (SANs)
sni.cloudflaressl.com, floweradvisor.co.id, *.floweradvisor.co.id
Not valid before
Sun, May 9o 2021, 12:00:00 am (z)
Not valid after
Sun, May 8o 2022, 11:59:59 pm (z)
Signature algorithm
ecdsaWithSha256
Issuer
Cloudflare Inc ECC CA-3
Intermediate certificate
Common name
Cloudflare Inc ECC CA-3
Organization
Cloudflare, Inc.
Location
US
Not valid before
Mon, January 27o 2020, 12:48:08 pm (z)
Not valid after
Tue, December 31o 2024, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Baltimore CyberTrust Root
Root certificate
Common name
Baltimore CyberTrust Root
Organization
Baltimore
Location
IE
Not valid before
Fri, May 12o 2000, 6:46:00 pm (z)
Not valid after
Mon, May 12o 2025, 11:59:00 pm (z)
Signature algorithm
sha1WithRsaEncryption
Issuer
Baltimore CyberTrust Root
Mixed Content Test (HTTP over HTTPS)
  • Congratulations, this webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test
  • This webpage is using the HTTP/2 protocol.
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We've found 2 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 62
Failed: 2
Warnings: 0
Passed: 7
Structured Data Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Custom 404 Error Page Test
  • Your website is not using a custom 404 error page. Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave your site entirely, and looks unprofessional. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://www.floweradvisor.co.id is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.floweradvisor.co.id" rel="canonical"/>
Nofollow Tag Test
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
See results list
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
Meta Refresh Test
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 mx include:spf.mailengine1.com ip4:49.50.8.21 -all
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved