seo site checkup logo
PricingFree ToolsArticles
Report generated 7 years ago
https://www.etickets.ca/toronto-blue-jays-tickets
Your general SEO Checkup Score
Archived
86/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 86 out of 100, which is higher than the average score of 75. Our analysis has identified 8 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
8 Failed
1 Warnings
40 Passed
Common SEO issues
Score: 89
Failed: 2
Warnings: 1
Passed: 18
Meta Title
  • Congratulations! Your webpage is using a title tag
Text: Toronto Blue Jays Tickets and Game Schedule at eTickets.ca
Meta Description
  • Congratulations! Your webpage is using a meta description tag
Text: Buy Toronto Blue Jays tickets from eTickets.ca and save up to $30. You can buy Toronto Blue Jays standard, VIP or playoff tickets at discounted price.
Google Search Results Preview
Desktop version
https://www.etickets.ca/toronto-blue-jays-ticketsToronto Blue Jays Tickets and Game Schedule at eTickets.caBuy Toronto Blue Jays tickets from eTickets.ca and save up to $30. You can buy Toronto Blue Jays standard, VIP or playoff tickets at discounted price.
Mobile version
https://www.etickets.ca/toronto-blue-jays-ticketsToronto Blue Jays Tickets and Game Schedule at eTickets.caBuy Toronto Blue Jays tickets from eTickets.ca and save up to $30. You can buy Toronto Blue Jays standard, VIP or playoff tickets at discounted price.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
198toronto168jays166blue102seats100starting
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud
anaheimangelesapplyarlingtonathleticsatlantabaltimorebaseballbluebostonbravesbronxcalgarycaliforniacanadacanadiancentrechampionshipcheckoutchicagoclearwaterclevelandcodedallasdetroitdiegodivisiondunedinedmontonenglishetickets.caeventsfansfenwayfieldfloridafranchisefranciscogamegamesgiantshistoryhomehoustonindiansjaysleaguemarylandmassachusettsmiamiminnesotamontrealoaklandofferohioontariooriolesottawapadresparkpetersburgphiladelphiaphilliespiratespittsburghprogressivepromoquebecraysrogersseasonseatsseriessportsspringstadiumstartingsupport@etickets.catampateamtexasticketstigerstimetooktorontotrainingtropicanatwinsvancouvervegaswashingtonwhitewinningwinnipegworldyankeesyearyearsyork
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your page contains too many H2 tags. H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Toronto Blue Jays Tickets - The Canadian Baseball Team
H2 tags
Notifications
LIMITED TIME OFFER
Take extra 10% off
Toronto Blue Jays vs. Cleveland Indians
Boston Red Sox vs. Toronto Blue Jays
New York Yankees vs. Toronto Blue Jays
Baltimore Orioles vs. Toronto Blue Jays
Toronto Blue Jays vs. Tampa Bay Rays
Toronto Blue Jays vs. Houston Astros
Tampa Bay Rays vs. Toronto Blue Jays
Spring Training: Toronto Blue Jays vs. Detroit Tigers
Spring Training: Baltimore Orioles vs. Toronto Blue Jays
Spring Training: New York Yankees vs. Toronto Blue Jays
Spring Training: Toronto Blue Jays vs. Boston Red Sox
Spring Training: Pittsburgh Pirates vs. Toronto Blue Jays
Spring Training: Toronto Blue Jays vs. Philadelphia Phillies (SS)
Spring Training: Atlanta Braves vs. Toronto Blue Jays (Split Squad)
Spring Training: Toronto Blue Jays vs. Pittsburgh Pirates
Spring Training: Toronto Blue Jays vs. Tampa Bay Rays (SS)
Spring Training: Toronto Blue Jays vs. New York Yankees (SS)
Spring Training: Detroit Tigers vs. Toronto Blue Jays
Spring Training: Toronto Blue Jays vs. Philadelphia Phillies
Spring Training: Tampa Bay Rays vs. Toronto Blue Jays
Spring Training: Pittsburgh Pirates vs. Toronto Blue Jays (Split Squad)
Spring Training: Philadelphia Phillies vs. Toronto Blue Jays
Spring Training: Minnesota Twins vs. Toronto Blue Jays
Spring Training: Toronto Blue Jays vs. Tampa Bay Rays
Spring Training: Toronto Blue Jays vs. New York Yankees
Spring Training: New York Yankees vs. Toronto Blue Jays (SS)
Spring Training: Toronto Blue Jays vs. Baltimore Orioles
Spring Training: Toronto Blue Jays vs. Minnesota Twins
Spring Training: Toronto Blue Jays vs. Detroit Tigers (SS)
Spring Training: Boston Red Sox vs. Toronto Blue Jays
Spring Training: Toronto Blue Jays vs. Atlanta Braves
Toronto Blue Jays vs. Detroit Tigers
Toronto Blue Jays vs. Baltimore Orioles
Cleveland Indians vs. Toronto Blue Jays
Oakland Athletics vs. Toronto Blue Jays
Toronto Blue Jays vs. San Francisco Giants
Toronto Blue Jays vs. Oakland Athletics
Los Angeles Angels of Anaheim vs. Toronto Blue Jays
Texas Rangers vs. Toronto Blue Jays
Toronto Blue Jays vs. Minnesota Twins
Toronto Blue Jays vs. Chicago White Sox
San Francisco Giants vs. Toronto Blue Jays
Toronto Blue Jays vs. Boston Red Sox
Toronto Blue Jays vs. San Diego Padres
Toronto Blue Jays Tickets – Who are the Toronto Blue Jays? Present and past
What’s in a name?
Toronto Blue Jays – The birth of a franchise until today
Toronto Blue Jays - Interesting Facts
Hurry...
Why eTickets.ca?
Similar Sports
Somerset Patriots
Rochester Red Wings
UConn Huskies Baseball
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test
  • All of your webpage's "img" tags have the required "alt" attribute.
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your webpage.
Social Media Check
  • Congratulations! Your website is connected successfully with social media using:
Facebook 
Speed optimizations
Score: 82
Failed: 2
Warnings: 0
Passed: 11
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 741.9 Kb to 49.08 Kb (93% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 1.36 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
  • Congratulations, your page has fewer than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from your server, which will ultimately slow down the loading of your web page.
Total Objects: 17
  • 1 HTML Pages
  • 1 CSS Files
  • 5 JS Files
  • 10 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Your site is not using cache headers for your images. The cache headers can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
JavaScript Minification Test
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test
  • Congratulations! Your website's CSS files are minified!
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Checker
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 69
Failed: 2
Warnings: 0
Passed: 4
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We've found 10 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 70
Failed: 2
Warnings: 0
Passed: 5
Microdata Schema Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://www.etickets.ca/toronto-blue-jays-tickets/ should be the preferred version of this page. The canonical tag can be useful when there are similar versions of the same content on several URLs (e.g., such as e-commerce sites where URL modifiers like sort parameters are appended to a product page's URL). Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.etickets.ca/toronto-blue-jays-tickets/" rel="canonical"/>
Nofollow Checker
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
See results list
Disallow Directive Checker
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF records checker
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 include:zoho.com ~all
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved