seo site checkup logo
PricingFree ToolsArticles
Report generated 5 hours ago
https://www.eticarettoplulugu.com
Your general SEO Checkup Score
Archived
79/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 79 out of 100, which is higher than the average score of 75. Our analysis has identified 10 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
10 Failed
4 Warnings
47 Passed
Issues to fix
HIGH
To address URL canonicalization issues, it is recommended to select a primary URL for your webpage and set up redirects from all other variations to the preferred one.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Add a robots.txt file to properly communicate with web crawlers and prevent unwanted access to sensitive content.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
LOW
Consider reducing the HTML size to improve loading times and retain visitors.
LOW
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
LOW
While a canonical link tag can help in resolving duplicate content issues, it's important to verify that the specified URL is accurate, especially if the site's URL structure has been recently updated.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
LOW
This website either lacks a favicon or it has not been referenced properly.
Common SEO issues
Score: 82
Failed: 2
Warnings: 2
Passed: 18
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: E Ticaret Topluluğu | E Ticaret Sitesi Satış Arttırma Forumu
Length: 60 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 140 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: E-Ticaret Topluluğu, e-ticaret yapan girişimci ve satıcılar için bilgi paylaşımı, tedarik, pazarlama ve büyüme odaklı güçlü bir platformdur.
Length: 140 characters
Google Search Results Preview Test
Desktop version
https://www.eticarettoplulugu.com/E Ticaret Topluluğu | E Ticaret Sitesi Satış Arttırma ForumuE-Ticaret Topluluğu, e-ticaret yapan girişimci ve satıcılar için bilgi paylaşımı, tedarik, pazarlama ve büyüme odaklı güçlü bir platformdur.
Mobile version
https://www.eticarettoplulugu.com/E Ticaret Topluluğu | E Ticaret Sitesi Satış Arttırma ForumuE-Ticaret Topluluğu, e-ticaret yapan girişimci ve satıcılar için bilgi paylaşımı, tedarik, pazarlama ve büyüme odaklı güçlü bir platformdur.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:description
E-Ticaret Topluluğu, e-ticaret yapan girişimci ve satıcılar için bilgi paylaşımı, tedarik, pazarlama ve büyüme odaklı güçlü bir platformdur.
og:site_name
E Ticaret Topluluğu | E Ticaret Sitesi Satış Arttırma Forumu
og:type
website
og:title
E Ticaret Topluluğu | E Ticaret Sitesi Satış Arttırma Forumu
og:url
https://www.eticarettoplulugu.com/
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
190konular156mesajlar143için113ticaret87kategorisi
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
konular
mesajlar
için
ticaret
kategorisi
Keywords Cloud Test
adminalanıdıralınıralıraramaartırmakayrıcabilgibilgilercevapcevaplardahadeneyimidestekdetaylıdijitaldoğrudropshippingdönüşümentegrasyonentegrasyonlarıetmekgerçekgibigooglegüncelgüvenilirgüçlühakkındahızlıisteyenisteyenleriçerikleriçinişletmelerişletmelerinkapsamlıkapsarkargokategorikategoridekategorisikaynakkonularkullanıcıkullanıcılarkullanımmağazamesajlarmüşterinasılniteliğindedirodaklıolarakoperasyoneloptimizasyonupaylaşılırpaylaşımpazarlamapazaryeriperformanspratikrehberreklamsaatsatışsayesindesağlayansiparişsistemlerisorusosyalstokstratejilerisunarsunulursürdürülebilirsüreçlerisüreçlerinitakibitekniktemelticarettrendyoluyumluveriverimliyapayyazılımyeniyönetimiyöntemlerizekaçözümlerçözümleriödemeönemliözelürünşekilde
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
E Ticaret Topluluğu | E Ticaret Sitesi Satış Arttırma Forumu
H2 tags
Genel Forumla alakalı genel tüm her şeyin yer aldığı kategori.
Google Google Kategorisi, Google ekosistemine ait tüm ürün, servis ve güncellemeler hakkında bilgi ve deneyim paylaşımlarının yapıldığı genel bir alandır. Bu kategoride; Google arama motoru, algoritma güncellemeleri, Google Search Console, Google Analytics, Google Ads, Google News ve diğer Google araçlarıyla ilgili konular ele alınır. Sıralama değişimleri, indeksleme sorunları, yeni özellikler ve resmi Google duyuruları hakkında güncel içerikler paylaşılır. Google’ı daha verimli kullanmak ve dijital projelerde avantaj sağlamak isteyenler için kapsamlı bir bilgi kaynağıdır.
SEO SEO Kategorisi, arama motorlarında üst sıralara çıkmak isteyen herkes için kapsamlı bilgi ve deneyim paylaşımlarının yer aldığı özel bir alandır. Bu kategoride Google SEO (Search Engine Optimization) başta olmak üzere arama motoru optimizasyonuna dair tüm temel ve ileri seviye konular detaylı şekilde ele alınır. Site içi SEO (on-page), site dışı SEO (off-page), teknik SEO, içerik optimizasyonu ve kullanıcı deneyimi gibi kritik başlıklar hakkında güncel ve uygulanabilir bilgiler bulabilirsiniz.
Dijital Reklam & Pazarlama Dijital Reklam & Pazarlama Kategorisi, markaların online kanallarda daha görünür, etkili ve ölçülebilir sonuçlar elde etmesini sağlayan stratejilerin paylaşıldığı bir alandır. Bu kategoride; Google Ads, sosyal medya reklamları, performans pazarlaması, yeniden pazarlama (remarketing), dönüşüm optimizasyonu ve bütçe yönetimi gibi konular ele alınır. Hedef kitle analizi, reklam metni optimizasyonu ve kampanya performans ölçümü hakkında güncel bilgiler sunulur. Dijitalde satışlarını ve marka bilinirliğini artırmak isteyenler için kapsamlı bir bilgi ve paylaşım kaynağıdır.
Grafik & Tasarım Grafik & Tasarım Kategorisi, markaların dijital ve görsel kimliğini güçlendirmeye yönelik tasarım çalışmalarının paylaşıldığı bir alandır. Bu kategoride; logo tasarımı, kurumsal kimlik, sosyal medya görselleri, reklam bannerları, web ve UI/UX tasarımı, afiş ve kreatif çalışmalar gibi konular ele alınır. Estetik, kullanıcı odaklı ve marka değerini yansıtan tasarım yaklaşımları hakkında bilgi ve deneyimler paylaşılır. Görsel kalitesini artırmak, profesyonel tasarım çözümleri bulmak ve yaratıcı fikirler geliştirmek isteyenler için kapsamlı bir kaynak niteliğindedir.
Pazar Yerleri Pazar Yerleri kategorisi, e-ticaret yapan işletmelerin ve girişimcilerin Trendyol, Hepsiburada, Amazon, N11 ve benzeri online pazaryerlerinde satış süreçlerini daha verimli yönetebilmesi için hazırlanmıştır. Bu kategoride pazaryeri mağaza açma, ürün listeleme, kategori optimizasyonu, fiyatlandırma stratejileri ve satış artırma yöntemleri hakkında SEO uyumlu ve güncel bilgiler yer alır. Pazaryeri algoritmaları, ürün sıralama kriterleri, kampanya ve indirim yönetimi gibi konular detaylı şekilde ele alınırken; sponsorlu reklamlar, performans raporları ve rekabet analizi gibi satış odaklı stratejilere de yer verilir. Ayrıca sipariş yönetimi, kargo süreçleri, iade politikaları ve müşteri memnuniyeti gibi operasyonel başlıklar bu kategorinin önemli parçalarıdır. Pazar yerlerinde görünürlüğünü artırmak, daha fazla organik satış elde etmek ve sürdürülebilir bir e-ticaret modeli oluşturmak isteyenler için bu kategori kapsamlı, rehber niteliğinde ve SEO odaklı bir bilgi kaynağı sunar.
E Ticaret Yazılımları E-Ticaret Yazılımları Kategorisi, online satış yapmak isteyen girişimciler ve işletmeler için kullanılan altyapı ve yazılım çözümlerinin ele alındığı bir paylaşım alanıdır. Bu kategoride; e-ticaret altyapıları, hazır yazılımlar, özel yazılım çözümleri, pazar yeri entegrasyonları, ödeme sistemleri, kargo entegrasyonları ve otomasyon araçları hakkında bilgiler paylaşılır. Yazılım karşılaştırmaları, kurulum süreçleri, maliyetler ve teknik avantajlar gibi konulara değinilir. Doğru e-ticaret yazılımını seçmek, satış süreçlerini verimli yönetmek ve ölçeklenebilir bir dijital mağaza kurmak isteyenler için rehber niteliğinde bir kaynaktır.
Dropshipping Dropshipping, ürün stoklamadan e-ticaret yapmayı mümkün kılan, düşük sermaye ile giriş yapılabilen bir satış modelidir. Bu iş modelinde satıcı, ürünleri kendi deposunda bulundurmaz; müşteri siparişi verdiğinde ürün doğrudan tedarikçi tarafından müşteriye gönderilir. Böylece stok maliyeti, depo giderleri ve lojistik riskler minimuma indirilir. Dropshipping sürecinde doğru ürün seçimi, güvenilir tedarikçiyle çalışma ve etkili pazarlama stratejileri büyük önem taşır. Ürün araştırması, fiyat rekabeti, kâr marjı hesaplaması ve müşteri memnuniyeti başarının temel unsurlarıdır. Ayrıca reklam yönetimi, sipariş takibi, iade süreçleri ve otomasyon sistemleri de işin sürdürülebilirliği açısından kritik rol oynar. E-ticarete hızlı başlamak, farklı ürünleri test etmek ve ölçeklenebilir bir iş modeli kurmak isteyen girişimciler için dropshipping, doğru stratejiyle uygulandığında güçlü bir fırsat sunar.
Ürün Toptancı / Üreticileri Ürün Toptancı / Üreticileri Kategorisi, e-ticaret yapanlar, bayiler ve işletmeler için doğrudan üretici ve toptancılarla bağlantı kurmayı amaçlayan bir alandır. Bu kategoride; yerli ve yabancı üreticiler, toptan ürün tedariki, minimum sipariş adetleri, fiyatlandırma modelleri, distribütörlük fırsatları ve lojistik süreçleri hakkında bilgiler paylaşılır. Güvenilir tedarikçi bulmak, kârlı ürünlere ulaşmak ve sürdürülebilir iş birlikleri kurmak isteyenler için rehber niteliğinde içerikler sunulur. Ticari ağını büyütmek isteyen kullanıcılar için önemli bir referans kaynağıdır.
ERP ve Operasyon Yönetimi ERP ve Operasyon Yönetimi kategorisi, işletmelerin tüm iş süreçlerini tek merkezden planlamasını, yönetmesini ve optimize etmesini sağlayan çözümleri kapsar. Bu alanda; muhasebe, stok yönetimi, tedarik zinciri, üretim, satış, insan kaynakları ve lojistik gibi temel operasyonların birbiriyle entegre şekilde nasıl yönetileceğine dair bilgiler paylaşılır. ERP sistemleri sayesinde veriler anlık olarak takip edilir, hatalar azalır ve karar alma süreçleri hızlanır. Bu kategori, hem küçük ve orta ölçekli işletmeler hem de kurumsal firmalar için operasyonel verimliliği artırmaya yönelik rehberler, yazılım karşılaştırmaları ve kullanım ipuçları sunar. Süreç otomasyonu, raporlama, maliyet kontrolü ve ölçeklenebilirlik gibi konular detaylı şekilde ele alınır. E-ticaret ve üretim yapan firmalar için ERP entegrasyonları, operasyonel yükü azaltırken sürdürülebilir büyümenin önünü açar. İş süreçlerini dijitalleştirmek ve daha kontrollü bir yapı kurmak isteyenler için bu kategori kapsamlı bir kaynak niteliğindedir.
Yapay Zeka Sistemleri Yapay Zeka Sistemleri kategorisi, işletmelerin ve dijital projelerin verimliliğini artırmak için kullanılan modern yapay zeka çözümlerini kapsamlı şekilde ele alır. Bu kategoride; makine öğrenimi, derin öğrenme, doğal dil işleme (NLP), görüntü tanıma ve otomasyon tabanlı yapay zeka sistemleri hakkında bilgilendirici içerikler yer alır. Yapay zekanın e-ticaret, dijital pazarlama, müşteri hizmetleri, veri analitiği ve operasyon yönetimindeki kullanım alanları detaylı olarak incelenir. Kategori kapsamında; yapay zeka destekli chatbotlar, öneri sistemleri, talep tahmini, fiyat optimizasyonu ve kişiselleştirme çözümleri gibi pratik uygulamalara odaklanılır. Ayrıca AI araçlarının entegrasyonu, veri güvenliği, etik kullanımı ve performans ölçümleme yöntemleri de ele alınır. İş süreçlerini otomatikleştirmek, karar alma mekanizmalarını güçlendirmek ve rekabet avantajı sağlamak isteyen işletmeler için Yapay Zeka Sistemleri kategorisi, güncel ve yol gösterici bir bilgi kaynağı sunar.
Kargo Kargo Kategorisi, e-ticaret ve ticari gönderim süreçlerinde kullanılan tüm kargo ve lojistik çözümlerini kapsayan bir paylaşım alanıdır. Bu kategoride; kargo firmaları, gönderim yöntemleri, teslimat süreleri, fiyatlandırma seçenekleri, entegrasyon sistemleri ve iade süreçleri hakkında bilgiler paylaşılır. Ayrıca kargo maliyetlerini düşürme, hızlı teslimat sağlama ve müşteri memnuniyetini artırmaya yönelik pratik öneriler yer alır. Gönderim süreçlerini daha verimli ve sorunsuz yönetmek isteyen kullanıcılar için rehber niteliğinde bir kaynaktır.
Robots.txt Test99% of top 100 sites passed
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
Image Alt Test78% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test29% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • This website either doesn't have a favicon or this has not been referenced correctly!
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Speed optimizations
Score: 76
Failed: 4
Warnings: 1
Passed: 15
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 3,117 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 314.43 Kb to 40.54 Kb (87% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 2.07 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage has less than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from the server, which will ultimately slow down the loading of your webpage.
Content size by content type
Content type
Percent
Size
javascript
54.6 %
200.72 Kb
image
21.9 %
80.70 Kb
css
12.4 %
45.61 Kb
html
11.0 %
40.44 Kb
other
0.1 %
405 B
font
0.0 %
0 B
TOTAL
100%
367.86 Kb
Requests by content type
Content type
Percent
Requests
image
45.0 %
9
javascript
25.0 %
5
css
20.0 %
4
html
5.0 %
1
other
5.0 %
1
font
0.0 %
0
TOTAL
100%
20
Content size by domain
Domain
Percent
Size
eticarettoplulugu.com
60.9 %
224.06 Kb
googletagmanager.com
39.1 %
143.80 Kb
TOTAL
100%
367.86 Kb
Requests by domain
Domain
Percent
Requests
eticarettoplulugu.com
95.0 %
19
googletagmanager.com
5.0 %
1
TOTAL
100%
20
CDN Usage Test95% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.254 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.254 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 1.616 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

1.616 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 2.14 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

2.14 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: 📢 Sponsorlu İçerik Ana Sayfa Forumlar Neler Yeni Kullanıcılar Giriş...
Html: <div class="p-pageWrapper" id="top">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0000. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.
0
Server and security
Score: 68
Failed: 2
Warnings: 0
Passed: 5
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.eticarettoplulugu.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
eticarettoplulugu.com
Subject Alternative Names (SANs)
*.eticarettoplulugu.com, eticarettoplulugu.com
Not valid before
Sat, January 17o 2026, 7:26:36 pm (z)
Not valid after
Fri, April 17o 2026, 7:26:35 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R13
Intermediate certificate
Common name
R13
Organization
Let's Encrypt
Location
US
Not valid before
Wed, March 13o 2024, 12:00:00 am (z)
Not valid after
Fri, March 12o 2027, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1, viewport-fit=cover" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 83
Failed: 2
Warnings: 1
Passed: 6
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://eticarettoplulugu.com/ should be the preferred version of this page. The canonical tag can be useful when there are similar versions of the same content on several URLs (e.g., such as e-commerce sites where URL modifiers like sort parameters are appended to a product page's URL). Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://eticarettoplulugu.com/" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 +a +mx include:relay.aktifdns.net ~all
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved