seo site checkup logo
PricingFree ToolsArticles
Report generated 21 days ago
https://www.dhumpwaterfitz.com
Your general SEO Checkup Score
Archived
64/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 64 out of 100, which is below the average score of 75. However, there are 22 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
22 Failed
5 Warnings
45 Passed
Issues to fix
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Connect your webpage with social media networks using APIs or AddThis, as social signals are becoming increasingly important for search engines to validate a site's trustworthiness and authority.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Serving resources (images, JS, CSS) from a CDN service, could improve website loading times, reduce bandwidth costs and increase content availability and redundancy.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a Time To First Byte value of 0.8 seconds or less.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a First Contentful Paint value of 1.8 seconds or less.
MEDIUM
Consider adding cache headers for JavaScript resources to speed up the webpage for returning users.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Consider adding cache headers for CSS resources to speed up the webpage for returning users.
LOW
Keep in mind that the NOINDEX meta tag instructs search engines not to index a webpage. Please verify if this is the intended behavior, as the webpage will not appear in search engine results.
LOW
For security reasons, it is recommended to turn off the server signature.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 52
Failed: 7
Warnings: 2
Passed: 16
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 18 characters. While there's no target number of characters, titles should be descriptive and concise. Using a title tag with less than 20 characters is a missed opportunity since it can be difficult to fit all your targeted keywords in such a short text.
    We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Home - Dhump Water
Length: 18 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 28 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Software Development Company
Length: 28 characters
Google Search Results Preview Test
Desktop version
https://dhumpwaterfitz.com/Home - Dhump WaterSoftware Development Company
Mobile version
https://dhumpwaterfitz.com/Home - Dhump WaterSoftware Development Company
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_US
og:type
website
og:title
Home - Dhump Water
og:description
Software Development Company
og:url
https://dhumpwaterfitz.com/
og:site_name
Dhump WaterFitz
og:updated_time
2025-08-02T15:12:56+00:00
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
137software130development49learn48services35solutions
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
software
development
learn
services
solutions
Keywords Cloud Test
agencyapplicationapplicationsappsaugmentationautomotivebasedbillingboostbudgetbuildbuildingbusinesscompanycontrolcostcostscustomdedicateddeliveringdesigndesigneddeveloperdevelopersdevelopmentdhumpdigitaldriveefficiencyefficientemailenergyensureensuringenterpriseentertainmentexperienceexpertsfinancialfirmfocusfoundergrowhavehealthcarehighhireindustriesjustlearnlearninglongmanagementmediamilestonemobilemodelneedsoperationaloperationsorganizationsperformanceplatformsprocessesproductprofitprojectprojectsqualityrealreliableretailsaasscaleschedulesecureserviceservicessoftwaresolssolutionsstaffstartupsstoriessuccesssuccessfulsupportsystemsteamtechnologiestelecommunicationstestingtimetodaytraveluseruserswaterfitzworkyears
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
Delivering Software Development Excellence for 14 Years
Latest Technologies to Help you Drive Scale
Get Software Solutions That Save You Money and Drive Results
Scale and Grow Your Startup with Expert Developmental Service
Our Process of Turning Your Ideas Into Reality
Why Choose Dhump Waterfitz for Your Software Development Needs?
Industries We Serve
Work Your Way with Our Flexible Collaboration Models
Technologies and Platforms We Hold Expertise In
Get a Personalized Quote For Your Software Solutions
What Happens When You Book a Call?
Frequently Asked Questions (FAQs)
Technology
Industries
Services
Solutions
Engagement Model
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
SEO Friendly URL Test29% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test10% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test75% of top 100 sites passed
  • This webpage is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 54
Failed: 11
Warnings: 2
Passed: 12
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 5,052 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 908.65 Kb to 189.75 Kb (79% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 5.4 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
61.8 %
779.49 Kb
javascript
14.7 %
184.78 Kb
html
14.5 %
182.41 Kb
css
5.3 %
66.83 Kb
font
3.8 %
47.37 Kb
other
0.0 %
0 B
TOTAL
100%
1.23 Mb
Requests by content type
Content type
Percent
Requests
image
43.0 %
52
css
26.4 %
32
javascript
24.8 %
30
font
5.0 %
6
html
0.8 %
1
other
0.0 %
0
TOTAL
100%
121
Content size by domain
Domain
Percent
Size
dhumpwaterfitz.com
96.2 %
1.19 Mb
dhumpwater.rehanayaz.com
3.8 %
47.37 Kb
TOTAL
100%
1.23 Mb
Requests by domain
Domain
Percent
Requests
dhumpwaterfitz.com
95.0 %
115
dhumpwater.rehanayaz.com
5.0 %
6
TOTAL
100%
121
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test95% of top 100 sites passed
  • This webpage is not serving resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test95% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is not using cache headers for JavaScript resources! Setting cache headers can help to speed up the webpage for returning users.
See results list
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using cache headers for CSS resources! Setting cache headers can help to speed up the webpage for returning users.
See results list
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test100% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test97% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 2.006 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

2.006 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 3.013 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

3.013 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 3.12 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

3.12 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: SOFTWARE DEVELOPMENT COMPANY Get Software Solutions That Save You Money and Driv...
Html: <div class="elementor-element elementor-element-ed81a82 e-flex..." data-id="ed81a82" data-element_type="container" data-settings="{"background_background":"classic"}">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0060. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.006

0.1

0.25

DOM element which contributes the most to CLS score:
Html:
Score: 0.0039
Server and security
Score: 93
Failed: 2
Warnings: 0
Passed: 8
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "dhumpwaterfitz.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
mail.mg.dhumpwaterfitz.info
Subject Alternative Names (SANs)
autodiscover.dhumpwaterfitz.info, cpanel.dhumpwaterfitz.info, cpcalendars.dhumpwaterfitz.info, cpcontacts.dhumpwaterfitz.info, dhumpwaterfitz.com, dhumpwaterfitz.info, dwsols.com, mail.dhumpwaterfitz.com, mail.dhumpwaterfitz.info, mail.dwsols.com, mail.mg.dhumpwaterfitz.info, mail.mg.dwsols.com, mg.dhumpwaterfitz.info, mg.dwsols.com, railsbuzz.dhumpwaterfitz.com, webdisk.dhumpwaterfitz.info, webmail.dhumpwaterfitz.info, www.dhumpwaterfitz.com, www.dhumpwaterfitz.info, www.dwsols.com, www.mg.dhumpwaterfitz.info, www.mg.dwsols.com, www.railsbuzz.dhumpwaterfitz.com
Not valid before
Wed, July 30o 2025, 6:58:51 am (z)
Not valid after
Tue, October 28o 2025, 6:58:50 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R10
Intermediate certificate
Common name
R10
Organization
Let's Encrypt
Location
US
Not valid before
Wed, March 13o 2024, 12:00:00 am (z)
Not valid after
Fri, March 12o 2027, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test95% of top 100 sites passed
Server: nginx/1.27.4
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 87
Failed: 2
Warnings: 1
Passed: 6
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage is using the noindex meta tag! This means that it will be read but not indexed by search engines.
See results list
Canonical Tag Test93% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 +mx +a include:relay.mailchannels.net +ip4:209.182.213.33 ~
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved