seo site checkup logo
PricingFree ToolsArticles
Report generated 6 years ago
https://www.deskera.in
Your general SEO Checkup Score
Archived
83/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 83 out of 100, which is higher than the average score of 75. Our analysis has identified 5 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
5 Failed
2 Warnings
41 Passed
Common SEO issues
Score: 93
Failed: 1
Warnings: 1
Passed: 17
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: CRM and ERP Software Company - Deskera India
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: Deskera, a leading provider of business management software in India, provides the best and preferred ERP, CRM, HRMS, PM software which helps small and medium businesses (SMEs) boost productivity and accelerate growth.
Google Search Results Preview Test
Desktop version
https://www.deskera.inCRM and ERP Software Company - Deskera IndiaDeskera, a leading provider of business management software in India, provides the best and preferred ERP, CRM, HRMS, PM software which helps small and medium businesses (SMEs) boost productivity and accelerate growth.
Mobile version
https://www.deskera.inCRM and ERP Software Company - Deskera IndiaDeskera, a leading provider of business management software in India, provides the best and preferred ERP, CRM, HRMS, PM software which helps small and medium businesses (SMEs) boost productivity and accelerate growth.
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
accountaccountsactivitiesadministrationallowsautomatebenefitsbetterbusinesscampaignscaseclaimsclickcloudcollaborationcompanycompletecontactcustomercustomersdatadeliverdeskeradetailsdocumenteasilyeclaimsefficienteleaveemailemployeeemployeesenterpriseetrainingfaqsfinancialgiveshelpshighhrmsimpactindiaindianintegratedinterfaceintuitiveinventoryleadingleadslearnleavemaintainmakemanagemanagementmanagingmastermoduleopportunityorganizationoutsidepartnerspayrollpeopleperformanceplanningprocessesprocessingproductproductsprogramprojectprojectsprovidesqualityreadyrealrecruitmentreportingreportsrequestresourceresourcessalesselfserviceservicessinglesoftwaresolutionstocksuccesstimetimesheettoolstracktraininguniqueuserview
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your page contains too many H2 tags. H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Software that helps you run your business
H2 tags
RUN YOUR
Deskera is an award-winning integrated business platform that helps you run your business.
Automate Business Processes with Deskera ERP
Sell More with Deskera CRM
Better HR, Better Enterprise Deskera HRMS
Say No to Slipped Deadlines with Deskera Project Management
Featured in Capterra’s Top 20
2015 Market Leadership Award for #1 Integrated Business Applications as a Service (BAaaS)
ERP CLOUD
CRM CLOUD
HRMS CLOUD
PROJECT CLOUD
Organizations of all sizes use Deskera
Go-live in hours, not days
Enterprise Resource Planning (ERP)
Customer Relationship Management (CRM)
Human Resource Management System (HRMS)
Project Management (PM)
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
SEO Friendly URL Test
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test
  • All of your webpage's "img" tags have the required "alt" attribute.
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Social Media Test
  • Congratulations! Your website is connected successfully with social media using:
Facebook Google Plus Twitter 
Speed optimizations
Score: 74
Failed: 3
Warnings: 1
Passed: 12
HTML Page Size Test
  • Congratulations! The size of your webpage's HTML is 19.71 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 92.9 Kb to 19.71 Kb (79% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 4.41 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
Total Objects: 35
  • 1 HTML Pages
  • 6 CSS Files
  • 9 JS Files
  • 19 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Image Caching Test
  • Congratulations! Your website is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Caching Test
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test
  • Congratulations! Your website is using cache headers for all CSS resources.
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Some of your webpage's CSS resources are not minified.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 90
Failed: 1
Warnings: 0
Passed: 4
URL Canonicalization Test
HTTPS Test
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We've found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 100
Failed: 0
Warnings: 0
Passed: 6
Structured Data Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://www.deskera.in is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.deskera.in/" rel="canonical"/>
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved