www.craftaffair.co.in SEO Report

Pricing Free Tools Articles

Report generated 4 hours ago

https://www.craftaffair.co.in

Your general SEO Checkup Score

Archived

71/100

SEO Score

Average SEO score of top 100 sites: 75%

This website received an SEO score of 71 out of 100, which is below the average score of 75. However, there are 16 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.

16 Failed

7 Warnings

51 Passed

Issues to fix

HIGH

To provide a good user experience, Google recommends that sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.

HIGH

It is recommended to avoid URL parameters and to use hyphens to separate words in the URL structure, rather than underscores.

HIGH

To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.

HIGH

To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.

HIGH

Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.

HIGH

Consider reducing the HTML size to improve loading times and retain visitors.

MEDIUM

To enhance website performance, it is recommended to implement a caching mechanism that delivers static HTML content.

MEDIUM

To provide a good user experience, Google recommends that sites should aim for a First Contentful Paint value of 1.8 seconds or less.

MEDIUM

Serve properly sized images to reduce page loading times and to improve user's experience.

MEDIUM

Avoid using distorted images, as they can have a negative impact on the user experience.

MEDIUM

Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.

LOW

Using more than 20 HTTP requests on a webpage can negatively impact the loading time.

LOW

Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.

LOW

Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.

LOW

Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.

Common SEO issues

Score: 65

Failed: 5

Warnings: 3

Passed: 18

Meta Title Test100% of top 100 sites passed

This webpage is using a title tag.

Text: Home Page - Craft Affair | The Macrame Shope

Length: 44 characters

Meta Description Test92% of top 100 sites passed

This webpage is using a meta description tag with a length of 131 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).

Text: Explore premium macrame thread, kits, beads, and tools for all your DIY crafting projects, perfect for crafters of any skill level.

Length: 131 characters

Google Search Results Preview Test

Desktop version

https://craftaffair.co.in/Home Page - Craft Affair | The Macrame ShopeExplore premium macrame thread, kits, beads, and tools for all your DIY crafting projects, perfect for crafters of any skill level.

Mobile version

Most Common Keywords Test

There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.

108options108product76combo57wishlist56select

Keywords Usage Test48% of top 100 sites passed

The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.

Keyword

Title tag

Meta description

Headings

options

product

combo

wishlist

select

Keywords Cloud Test

accessoriesaccountaffairbabybeadsbeigeblackbluebottlebraidedbrowncartcategorycharcoalchoosingchosenclapscloudcoffeecollectionscolorcombocommentscontactcordcottoncraftcraftingcreativitycrochetcustomizecutoutsdecordustyexplorefeaturedfollowgreengreyhighhobbiesitemsjewellerykeychainlavenderleaflemonlippanlobstermacramemadhubanimakingmaroonmelangemenumetalmintmultimultiplemustardnavyoliveoptionsorangepagepaintingpeachpeacockpinkproductproductsprojectspursequalityraniresinringroyalrussianrustsandsearchselectshopsinglesteelstonestrandthicknesstitletwistedtypevariantsvariousvioletwallwaterwhitewishlistwooden

Competitor Domains Test

Heading Tags Test62% of top 100 sites passed

This webpage contains headings tags.

Shop High-Quality Macrame Thread & Craft Supplies for All Your DIY Creations

Robots.txt Test99% of top 100 sites passed

This website is using a robots.txt file.

https://craftaffair.co.in/robots.txt

Sitemap Test83% of top 100 sites passed

This website has a sitemap file.

https://craftaffair.co.in/sitemap_index.xml

Broken Links Test

SEO Friendly URL Test29% of top 100 sites passed

This webpage contains URLs that are not SEO friendly!

Image Alt Test78% of top 100 sites passed

This webpage is using "img" tags with empty or missing "alt" attribute!

Responsive Image Test29% of top 100 sites passed

Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.

Image Aspect Ratio Test75% of top 100 sites passed

Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!

Inline CSS Test10% of top 100 sites passed

This webpage is using inline CSS styles!

Deprecated HTML Tags Test94% of top 100 sites passed

This webpage does not use HTML deprecated tags.

Google Analytics Test72% of top 100 sites passed

This webpage is using Google Analytics.

Favicon Test100% of top 100 sites passed

This website appears to have a favicon.

Backlinks Test

JS Error Test83% of top 100 sites passed

There are no severe JavaScript errors on this webpage.

Console Errors Test27% of top 100 sites passed

This webpage has some warnings caught by the Chrome DevTools Console!

Charset Declaration Test96% of top 100 sites passed

This webpage has a character encoding declaration.

Content-Type: text/html; charset=UTF-8

Speed optimizations

Score: 57

Failed: 9

Warnings: 3

Passed: 13

HTML Page Size Test23% of top 100 sites passed

The size of this webpage's HTML is 81.96 Kb, and is greater than the average size of 33 Kb! This can lead to slower loading times, lost visitors, and decreased revenue. Good steps to reduce HTML size include: using HTML compression, CSS layouts, external style sheets, and moving javascript to external files.

DOM Size Test56% of top 100 sites passed

The Document Object Model (DOM) of this webpage has 3,917 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.

HTML Compression/GZIP Test99% of top 100 sites passed

This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 966.39 Kb to 81.96 Kb (92% size savings). This helps ensure a faster loading webpage and improved user experience.

Site Loading Speed Test71% of top 100 sites passed

The loading time of this webpage (measured from N. Virginia, US) is around 12.72 seconds and is greater than the average loading speed which is 5 seconds!

JS Execution Time Test53% of top 100 sites passed

The JavaScript code used by this webpage is executed in less than 2 seconds.

Page Objects Test

This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!

Content size by content type

Content type

Percent

Size

image

57.9 %

1.15 Mb

javascript

24.2 %

490.26 Kb

css

8.1 %

164.90 Kb

html

7.0 %

141.97 Kb

font

2.8 %

57.55 Kb

other

0.0 %

19 B

Requests by content type

Content type

Percent

Requests

css

47.1 %

106

javascript

29.3 %

image

20.0 %

font

2.7 %

html

0.4 %

other

0.4 %

Content size by domain

Domain

Percent

Size

craftaffair.co.in

84.3 %

1.67 Mb

googletagmanager.com

9.3 %

189.42 Kb

connect.facebook.net

3.7 %

74.91 Kb

fonts.gstatic.com

2.3 %

45.85 Kb

fonts.googleapis.com

0.2 %

4.32 Kb

googleads.g.doubleclick.net

0.1 %

2.25 Kb

secure.gravatar.com

0.1 %

1.25 Kb

google.com

0.0 %

64 B

facebook.com

0.0 %

19 B

Requests by domain

Domain

Percent

Requests

craftaffair.co.in

93.3 %

210

fonts.gstatic.com

2.2 %

fonts.googleapis.com

0.9 %

googletagmanager.com

0.9 %

connect.facebook.net

0.9 %

secure.gravatar.com

0.4 %

googleads.g.doubleclick.net

0.4 %

google.com

0.4 %

facebook.com

0.4 %

Page Cache Test (Server Side Caching)100% of top 100 sites passed

It doesn't appear that this website is caching webpages. Cached pages serve up static html and avoid potentially time consuming queries to your database. It also helps lower server load by up to 80%. Caching most visibly benefits high traffic pages that access a database, but whose content does not change on every page view. Common caching methods include Alternative PHP Cache, Quickcache, and WP Super Cache (for Wordpress sites). Caching mechanisms also typically compress HTML, further reducing page size and load time.

Flash Test100% of top 100 sites passed

This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.

CDN Usage Test95% of top 100 sites passed

This webpage is not serving all resources (images, javascript and css) from CDNs!

Modern Image Format Test43% of top 100 sites passed

This webpage is using images in a modern format.

Image Metadata Test72% of top 100 sites passed

This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.

Image Caching Test95% of top 100 sites passed

This website is using cache headers for images and the browsers will display these images from the cache.

JavaScript Caching Test96% of top 100 sites passed

This webpage is using cache headers for all JavaScript resources.

CSS Caching Test98% of top 100 sites passed

This webpage is using cache headers for all CSS resources.

JavaScript Minification Test98% of top 100 sites passed

All JavaScript files used by this webpage are minified.

CSS Minification Test100% of top 100 sites passed

All CSS resources used by this webpage are minified.

Render Blocking Resources Test15% of top 100 sites passed

This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.

Nested Tables Test100% of top 100 sites passed

This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.

Frameset Test100% of top 100 sites passed

This webpage does not use frames.

Doctype Test100% of top 100 sites passed

This webpage has a doctype declaration.

<!DOCTYPE html>

URL Redirects Test97% of top 100 sites passed

This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.

https://www.craftaffair.co.in/https://craftaffair.co.in/

Time To First Byte Test99% of top 100 sites passed

The Time To First Byte value of this webpage is 1.336 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

1.336 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed

The First Contentful Paint value of this webpage is 7.783 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

7.783 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed

The Largest Contentful Paint duration of this webpage is 9.37 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

9.37 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:

Cumulative Layout Shift Test91% of top 100 sites passed

The CLS score of this webpage is 0.0014. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0014

0.1

0.25

DOM element which contributes the most to CLS score:

Text: LOGIN / REGISTER ** 0 ₹0.00

Html: <div class="whb-column whb-col-right whb-visible-lg">

Score: 0.0010

Server and security

Score: 97

Failed: 1

Warnings: 0

Passed: 9

URL Canonicalization Test93% of top 100 sites passed

https://craftaffair.co.in/ and https://www.craftaffair.co.in/ resolve to the same URL.

SSL Checker and HTTPS Test100% of top 100 sites passed

This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "craftaffair.co.in" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:

Server certificate

Common name

craftaffair.co.in

Subject Alternative Names (SANs)

craftaffair.co.in, www.craftaffair.co.in

Not valid before

Fri, December 6o 2024, 5:25:32 am (z)

Not valid after

Thu, March 6o 2025, 5:25:31 am (z)

Signature algorithm

sha256WithRsaEncryption

Issuer

WR1

Intermediate certificate

Common name

WR1

Organization

Google Trust Services

Location

Not valid before

Wed, December 13o 2023, 9:00:00 am (z)

Not valid after

Tue, February 20o 2029, 2:00:00 pm (z)

Signature algorithm

sha256WithRsaEncryption

Issuer

GTS Root R1

Root certificate

Common name

GTS Root R1

Organization

Google Trust Services LLC

Location

Not valid before

Wed, June 22o 2016, 12:00:00 am (z)

Not valid after

Sun, June 22o 2036, 12:00:00 am (z)

Signature algorithm

sha384WithRsaEncryption

Issuer

GTS Root R1

Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed

This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.

HTTP2 Test99% of top 100 sites passed

This webpage is using the HTTP/2 protocol.

HSTS Test84% of top 100 sites passed

This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.

Safe Browsing Test100% of top 100 sites passed

This website is not currently listed as suspicious (no malware or phishing activity found).

Server Signature Test95% of top 100 sites passed

The server signature is off for this webpage.

Directory Browsing Test100% of top 100 sites passed

Directory browsing is disabled for this website.

Plaintext Emails Test97% of top 100 sites passed

This webpage does not include email addresses in plaintext.

Unsafe Cross-Origin Links Test45% of top 100 sites passed

This webpage is not using target="_blank" links without rel="noopener" or rel="noreferrer" attribute.

Mobile usability

Score: 100

Failed: 0

Warnings: 0

Passed: 3

Meta Viewport Test92% of top 100 sites passed

This webpage is using a viewport meta tag.

<meta name="viewport" content="width=device-width, initial-scale=1.0, maximum-scale=1.0, user-scalable=no" />

Media Query Responsive Test98% of top 100 sites passed

This webpage is using CSS media queries, which is the base for responsive design functionalities.

Mobile Snapshot Test

Advanced SEO

Score: 98

Failed: 1

Warnings: 1

Passed: 8

Structured Data Test66% of top 100 sites passed

This webpage is using structured data.

Custom 404 Error Page Test80% of top 100 sites passed

This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.

Noindex Tag Test99% of top 100 sites passed

This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.

Canonical Tag Test93% of top 100 sites passed

This webpage is using the canonical link tag. This tag specifies that the URL: https://craftaffair.co.in/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.

<link href="https://craftaffair.co.in/" rel="canonical"/>

Nofollow Tag Test

This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.

Disallow Directive Test

Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).

Meta Refresh Test98% of top 100 sites passed

This webpage is not using a meta refresh tag.

SPF Records Test94% of top 100 sites passed

This DNS server is using an SPF record.

v=spf1 include:_spf.mail.hostinger.com ~all

Ads.txt Validation Test67% of top 100 sites passed

This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.

Spell Check Test

Report generated 4 hours ago

https://www.craftaffair.co.in

Your general SEO Checkup Score

Archived

71/100

SEO Score

Average SEO score of top 100 sites: 75%

16 Failed

7 Warnings

51 Passed

Issues to fix

HIGH

To provide a good user experience, Google recommends that sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.

HIGH

It is recommended to avoid URL parameters and to use hyphens to separate words in the URL structure, rather than underscores.

HIGH

To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.

HIGH

To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.

HIGH

Consider reducing the HTML size to improve loading times and retain visitors.

MEDIUM

To enhance website performance, it is recommended to implement a caching mechanism that delivers static HTML content.

MEDIUM

To provide a good user experience, Google recommends that sites should aim for a First Contentful Paint value of 1.8 seconds or less.

MEDIUM

Serve properly sized images to reduce page loading times and to improve user's experience.

MEDIUM

Avoid using distorted images, as they can have a negative impact on the user experience.

MEDIUM

LOW

Using more than 20 HTTP requests on a webpage can negatively impact the loading time.

LOW

Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.

LOW

Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.

LOW

Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.

Website SEO, Monitoring & Automation Made Easy.

Product

Pricing
Free Tools
Articles
Login
Free 7-Day Trial

Company

Legal

Find the keywords where this URL is listed in the top 20 results of Google's organic listings.

Understand your competitors' SEO and backlink profile

Looking for a Sitemap Generator Tool?

Check your webpage for broken links!

Get a full and detailed list of your backlinks!

Accurate loading speed and website loading speed monitor

Check your webpage for misspellings!