seo site checkup logo
PricingFree ToolsArticles
Report generated 9 months ago
https://www.coverfox.com/health-insurance
Your general SEO Checkup Score
Archived
83/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 83 out of 100, which is higher than the average score of 75. Our analysis has identified 11 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
11 Failed
6 Warnings
56 Passed
Issues to fix
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Use only one canonical link tag per webpage, as multiple tags will cause search engines to ignore all of them, potentially leading to duplicate content issues.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Replace deprecated HTML tags with their modern equivalents or appropriate CSS rules.
Common SEO issues
Score: 76
Failed: 4
Warnings: 4
Passed: 17
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Compare & Buy Best Health Insurance Plans Online India
Length: 54 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 148 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Get instant quotes, compare policies, and purchase comprehensive health insurance online from leading insurers in India. Explore your options today!
Length: 148 characters
Google Search Results Preview Test
Desktop version
https://www.coverfox.com/health-insurance/Compare & Buy Best Health Insurance Plans Online IndiaGet instant quotes, compare policies, and purchase comprehensive health insurance online from leading insurers in India. Explore your options today!
Mobile version
https://www.coverfox.com/health-insurance/Compare & Buy Best Health Insurance Plans Online IndiaGet instant quotes, compare policies, and purchase comprehensive health insurance online from leading insurers in India. Explore your options today!
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:title
Compare & Buy Best Health Insurance Plans Online India
og:type
article
og:url
https://www.coverfox.com/health-insurance/
og:image
https://cms-img.coverfox.com/health-insurance-new-images.jpeg
og:description
Get instant quotes, compare policies, and buy comprehensive health insurance online from top insurers in India.
og:site_name
Coverfox Insurance
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
238insurance185health73plan57plans57coverage
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
insurance
health
plan
plans
coverage
Keywords Cloud Test
accessadditionalaffordableailmentsallowallowsarticlesbenefitsbestbikebonusbuyingcalculatorcarecashlesschargeschildrenclaimcompaniescompareconsideringcostcostscovercoveragecoveredcoverfoxcriticaldependingdifferentdischargediscountdocumentseasyensureexclusionsexpensesfamilyfinancialgeneralhavehealthhealthcarehigherhospitalhospitalisationhospitalsillnessincludeincurredindiainflationinsuranceinsuredinsurerissueslakhlifelikelimitlistmedicalmonthneednetworkofferoptimumparentspaymentperiodplanplanspocketpoliciespolicypostpremiumprotectionpurchasepurchasingqualityquotesreimbursementrenewalrentroomselfseniorsinglespecificstandardtermtermstreatmenttreatmentsuptousuallyvarywaitingyears
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Health Insurance
H2 tags
Buy Best Health Insurance Plan By Different Insurer
Buy Best Health Insurance Plans as Per Coverage
What is Health Insurance?
Why Health Insurance?
Importance of Buying Health Insurance
Features of Buying Health Insurance
Benefits of Buying Health Insurance
Key Benefits of Cashless Treatment at Any Hospital
Checklist to Buy Health Insurance
Top Reasons to Buy Health Insurance
Check the Differences Between Health Insurance and Medical Insurance
Types of Best Health Insurance Plans Online
List of India's Health Insurance Providers
General Insurance Companies in India
Comparing Health Insurance Plans and Why is It Important?
What is Covered Under a Health Insurance Plan?
What is Not Covered Under a Health Insurance Plan?
Why is Health Insurance So Important?
Why Buy Health Insurance from Coverfox?
Eligibility to Buy Health Insurance
List of Documents Necessary to Buy and Claim Health Insurance Plan
How to Claim a Health Insurance Policy Online?
Tax Benefits Under Buying Health Insurance Policy
Conclusion
Frequently Asked Questions
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test74% of top 100 sites passed
  • This website has a sitemap file.
SEO Friendly URL Test25% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test28% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test8% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • We found some HTML deprecated tags! You are advised to change these old tags with equivalent tags or proper CSS rules.
61center
Google Analytics Test65% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test41% of top 100 sites passed
  • This webpage has some warnings caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Social Media Test57% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 83
Failed: 4
Warnings: 1
Passed: 20
HTML Page Size Test21% of top 100 sites passed
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,127 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 239.06 Kb to 42.04 Kb (82% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 2.78 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
font
28.3 %
78.96 Kb
image
25.5 %
71.22 Kb
css
19.7 %
54.92 Kb
html
15.1 %
42.15 Kb
javascript
11.1 %
30.86 Kb
other
0.3 %
851 B
TOTAL
100%
278.94 Kb
Requests by content type
Content type
Percent
Requests
image
32.6 %
14
css
27.9 %
12
javascript
25.6 %
11
font
7.0 %
3
html
4.7 %
2
other
2.3 %
1
TOTAL
100%
43
Content size by domain
Domain
Percent
Size
assets.coverfox.com
50.2 %
139.94 Kb
fonts.gstatic.com
25.8 %
71.99 Kb
coverfox.com
18.6 %
51.94 Kb
cms-img.coverfox.com
5.0 %
14.06 Kb
fonts.googleapis.com
0.4 %
1.01 Kb
TOTAL
100%
278.94 Kb
Requests by domain
Domain
Percent
Requests
assets.coverfox.com
74.4 %
32
coverfox.com
9.3 %
4
cms-img.coverfox.com
9.3 %
4
fonts.gstatic.com
4.7 %
2
fonts.googleapis.com
2.3 %
1
TOTAL
100%
43
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test97% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test97% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test96% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test96% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test98% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.247 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.247 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 1.401 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

1.401 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 1.24 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.24 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Get Lowest Rates for Health Insurance Mediclaim Plans Starting @ Rs 250* / Mont...
Html: <div class="banner-bg">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0037. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0037

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Top Plan Raheja QBE Insurance Amount Covered 4 Lakh Premium ₹ 344/Month* Room re...
Html: <div class="carousel__content cf-cms-carousel-plans" data-cms-attr="class:carouselContentClass" tabindex="0">
Score: 0.0030
Server and security
Score: 93
Failed: 1
Warnings: 0
Passed: 9
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.coverfox.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
coverfox.com
Subject Alternative Names (SANs)
coverfox.com, *.pos.coverfox.com, *.coverfox.com
Not valid before
Sun, January 21o 2024, 12:00:00 am (z)
Not valid after
Tue, February 18o 2025, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Amazon RSA 2048 M02
Intermediate certificate
Common name
Amazon RSA 2048 M02
Organization
Amazon
Location
US
Not valid before
Tue, August 23o 2022, 10:25:30 pm (z)
Not valid after
Fri, August 23o 2030, 10:25:30 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Amazon Root CA 1
Root certificate
Common name
Amazon Root CA 1
Organization
Amazon
Location
US
Not valid before
Tue, May 26o 2015, 12:00:00 am (z)
Not valid after
Sun, January 17o 2038, 12:00:00 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Amazon Root CA 1
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test82% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=2592000
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test98% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test100% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0, maximum-scale=1.0, user-scalable=no" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 87
Failed: 2
Warnings: 1
Passed: 7
Structured Data Test53% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • We've found multiple canonical link tags. When more than one is specified, all canonical tags will be ignored!
<link href="https://www.coverfox.com/health-insurance/" rel="canonical"/>
<link data-cms-attr="href:canonicalUrl" href="https://www.coverfox.com/health-insurance/" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:sendgrid.net include:spf.mandrillapp.com include:amazonses.com include:_spf.google.com -all
Ads.txt Validation Test68% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved