seo site checkup logo
PricingFree ToolsArticles
Report generated a year ago
https://www.cosmopolitan.co.kr/article/82240
Your general SEO Checkup Score
Archived
65/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 65 out of 100, which is below the average score of 75. However, there are 20 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
20 Failed
7 Warnings
47 Passed
Issues to fix
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
HTTP/2 protocol offers several key improvements, including faster page load times, improved performance, better security and more efficient use of network resources.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a First Contentful Paint value of 1.8 seconds or less.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Consider adding cache headers for images to improve website performance. With cache headers, browsers can cache images and serve them quickly to returning visitors, rather than re-fetching them each time.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
For security reasons, it is recommended to turn off the server signature.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
LOW
This website either lacks a favicon or it has not been referenced properly.
Common SEO issues
Score: 70
Failed: 5
Warnings: 3
Passed: 18
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 66 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: 겨울 피부는 이렇게! 안소희·이청아가 듬뿍 바르는 ‘00’ || 코스모폴리탄코리아 (COSMOPOLITAN KOREA)
Length: 66 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 22 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: 괜히 아기 피부, 꿀 피부가 아니다.
Length: 22 characters
Google Search Results Preview Test
Desktop version
https://www.cosmopolitan.co.kr/article/82240겨울 피부는 이렇게! 안소희·이청아가 듬뿍 바르는 ‘00’ || 코스모폴리탄코리아 (COSMOPOLITAN KOREA)괜히 아기 피부, 꿀 피부가 아니다.
Mobile version
https://www.cosmopolitan.co.kr/article/82240겨울 피부는 이렇게! 안소희·이청아가 듬뿍 바르는 ‘00’ || 코스모폴리탄코리아 (COSMOPOLITAN KOREA)괜히 아기 피부, 꿀 피부가 아니다.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:site_name
COSMOPOLITAN
og:description
괜히 아기 피부, 꿀 피부가 아니다.
og:title
겨울 피부는 이렇게! 안소희·이청아가 듬뿍 바르는 ‘00’
og:url
https://www.cosmopolitan.co.kr/article/82240
og:image
https://image.jtbcplus.kr/data/contents/ham_photo/202311/20/0281ce25-390c-409d-9606-c3caab98bd75.jpg
og:type
article
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
7beauty3fashion3career3society3event
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
beauty
fashion
career
society
event
Keywords Cloud Test
accessoriesbeautycareercelebcelebritycelebscomecosmopolitanculturedesignerseventfashionfitnessfoodgossiphairhealthhomehoroscopeinterviewitemlifeloginlogoutmakemattersmentormypagenewsnoticeongoingplacepoliticsreviewshoppingsignupskincaresocietystreetstyletastetechtipstraveltrendsweekwomen강조했다고객센터고인물템기본적인깨어나면넘겨보는느껴지는돌돌이로라로슈포제레이어링을로그인하기마사지도만나보세요몽쥬약국에서미디어킷베이커리비타민은사용하다사용한다사용할까소장하는스텝퍼라고슬리핑팩으로시카밤은시카밤을신민아가신청하기앰배서더까지오랫동안요즘처럼원더걸스이야기다이청아가읽기에서정기구독정기구독으로제형으로제휴문의종류별로중요하다고지킨다고채널에서챙겨먹고챙겨먹는다고추천템은카카오톡컨디션에코스모폴리탄코엔자임크리스마스포인트제도푸석푸석하게허스트중앙
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
COSMOPOLITAN
H2 tags
<코스모폴리탄> 정기구독
겨울 피부는 이렇게! 안소희·이청아가 듬뿍 바르는 ‘00’
수건도 따로 쓴다고? 윤은혜 피부 관리 TIP
꿀 피부 각? 한혜진의 나이트 루틴 최초 공개!
이나연 추천! 환절기 피부, 2주 만에 꿀피부 된다고?
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test74% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test25% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test28% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test8% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • This website either doesn't have a favicon or this has not been referenced correctly!
JS Error Test79% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test41% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test57% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 64
Failed: 7
Warnings: 3
Passed: 15
HTML Page Size Test21% of top 100 sites passed
  • The size of this webpage's HTML is 22.91 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 703 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 107.56 Kb to 22.91 Kb (79% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 8.93 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
57.7 %
6.17 Mb
other
19.4 %
2.08 Mb
javascript
11.4 %
1.22 Mb
font
7.0 %
762.62 Kb
html
2.7 %
293.74 Kb
css
1.7 %
189.73 Kb
TOTAL
100%
10.69 Mb
Requests by content type
Content type
Percent
Requests
image
35.8 %
76
font
20.8 %
44
javascript
17.9 %
38
other
14.2 %
30
html
8.5 %
18
css
2.8 %
6
TOTAL
100%
212
Content size by domain
Domain
Percent
Size
image.jtbcplus.kr
55.7 %
5.96 Mb
incontents.contentslabs.com
19.4 %
2.07 Mb
googletagmanager.com
5.6 %
608.86 Kb
fonts.gstatic.com
5.2 %
574.30 Kb
www02.cosmopolitan.co.kr
5.2 %
573.55 Kb
imasdk.googleapis.com
3.4 %
366.71 Kb
fonts.googleapis.com
1.4 %
154.91 Kb
cosmopolitan.co.kr
0.8 %
89.31 Kb
static.dable.io
0.5 %
55.64 Kb
static.criteo.net
0.4 %
42.52 Kb
Other
2.3 %
256.92 Kb
TOTAL
100%
10.69 Mb
Requests by domain
Domain
Percent
Requests
www02.cosmopolitan.co.kr
24.1 %
51
fonts.gstatic.com
17.5 %
37
image.jtbcplus.kr
7.5 %
16
analytics.google.com
4.2 %
9
googletagmanager.com
3.3 %
7
images.dable.io
3.3 %
7
cosmopolitan.co.kr
2.8 %
6
stats.g.doubleclick.net
2.8 %
6
compass.adop.cc
2.8 %
6
ad-log.dable.io
2.8 %
6
Other
28.8 %
61
TOTAL
100%
212
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test97% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test97% of top 100 sites passed
See results list
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test96% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test96% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test98% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.448 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.448 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 3.206 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

3.206 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 3.34 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

3.34 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text:     시카밤을 슬리핑팩으로 이청아 크게 보기 이전 다음 1 OF 3 10년 전 지인이 몽쥬약국에서 사다 준 것을 계기로 오랫동안 사용...
Html: <div class="atc_content" data-contents-idx="82240" itemprop="articleBody">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.1695. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.1695

0.1

0.25

DOM element which contributes the most to CLS score:
Text: 전체 메뉴 열기 COSMOPOLITAN FASHION BEAUTY CELEBS LIFE CAREER HOROSCOPE EVENT LOGIN   ...
Html: <div id="wrap" class="view">
Score: 0.1432
Server and security
Score: 64
Failed: 4
Warnings: 1
Passed: 5
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using the HTTPS protocol, but the SSL Certificate will expire in less than a month! Having an up-to-date certificate is an important security practice to ensure that your website is safe and provides trust, and any communication between the user's browser and your website (such as passwords, credit cards, or forms) is encrypted and private.

The certificate is not used before the activation date.

The certificate will expire in less than a month!

The hostname "www.cosmopolitan.co.kr" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.cosmopolitan.co.kr
Organization
ContentreeJoongAng corp.
Location
Gangnam-gu, Seoul, KR
Subject Alternative Names (SANs)
*.cosmopolitan.co.kr, cosmopolitan.co.kr
Not valid before
Tue, November 8o 2022, 12:00:00 am (z)
Not valid after
Fri, December 8o 2023, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Thawte RSA CA 2018
Intermediate certificate
Common name
Thawte RSA CA 2018
Organization
DigiCert Inc
Location
US
Not valid before
Mon, November 6o 2017, 12:23:52 pm (z)
Not valid after
Sat, November 6o 2027, 12:23:52 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
DigiCert Global Root CA
Root certificate
Common name
DigiCert Global Root CA
Organization
DigiCert Inc
Location
US
Not valid before
Fri, November 10o 2006, 12:00:00 am (z)
Not valid after
Mon, November 10o 2031, 12:00:00 am (z)
Signature algorithm
sha1WithRsaEncryption
Issuer
DigiCert Global Root CA
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is not using the HTTP/2 protocol!
HSTS Test82% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test98% of top 100 sites passed
Server: Microsoft-IIS/8.5
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test100% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 27
Failed: 4
Warnings: 0
Passed: 6
Structured Data Test53% of top 100 sites passed
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test68% of top 100 sites passed
  • This website is using an Authorized Digital Sellers (ads.txt) file, but its content has invalid records! Having errors in this file would cause advertisers to not recognize and ignore the authorized sellers list and that will lead to lost revenue.
See results list
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved