seo site checkup logo
PricingFree ToolsArticles
Report generated a year ago
https://www.clevermarket.gr
Your general SEO Checkup Score
Archived
69/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 69 out of 100, which is below the average score of 75. However, there are 17 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
17 Failed
4 Warnings
53 Passed
Issues to fix
HIGH
It is recommended to avoid URL parameters and to use hyphens to separate words in the URL structure, rather than underscores.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
Common SEO issues
Score: 69
Failed: 5
Warnings: 1
Passed: 20
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Καλώς ήλθατε στην Clevermarket
Length: 30 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Βρείτε έξυπνα ηλεκτρονικά για κάθε ανάγκη. Οικονομικές & πρακτικές λύσεις όπως προϊόντα καταγραφής ήχου και εικόνας, συναγερμοί, κάμερες, μεταφραστές.
Length: 150 characters
Google Search Results Preview Test
Desktop version
https://www.clevermarket.gr/Καλώς ήλθατε στην ClevermarketΒρείτε έξυπνα ηλεκτρονικά για κάθε ανάγκη. Οικονομικές & πρακτικές λύσεις όπως προϊόντα καταγραφής ήχου και εικόνας, συναγερμοί, κάμερες, μεταφραστές.
Mobile version
https://www.clevermarket.gr/Καλώς ήλθατε στην ClevermarketΒρείτε έξυπνα ηλεκτρονικά για κάθε ανάγκη. Οικονομικές & πρακτικές λύσεις όπως προϊόντα καταγραφής ήχου και εικόνας, συναγερμοί, κάμερες, μεταφραστές.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:image:height
100
og:description
Βρείτε έξυπνα ηλεκτρονικά για κάθε ανάγκη. Οικονομικές & πρακτικές λύσεις όπως προϊόντα καταγραφής ήχου και εικόνας, συναγερμοί, κάμερες, μεταφραστές.
og:image
https://static.clevermarket.gr/uploads/sites/105896/siteimage-ogimage.png?lm=f55999a3e247abb7760ad57e90c6c53e
og:image:width
100
og:type
website
og:site_name
Clevermarket
og:title
Καλώς ήλθατε στην Clevermarket
og:url
https://www.clevermarket.gr/
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
68πισω68κατηγορια63αγορα62κάμερες49προϊόντα
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
πισω
κατηγορια
αγορα
κάμερες
προϊόντα
Keywords Cloud Test
bluetoothcampingcctvcleverclevermarketemailgadgetgadgetsinverterlaptoplaserminitelemarketingtrackerswifiέξυπναέξυπνεςήχοςήχουαγοραακουστικάανεμιστήρεςαξεσουάρασφαλείαςασύρματααυτοκινήτουγραφείουγυαλιάγυμναστικήςδείτεδιάφοραδιακοσμητικάδώραείδηεγγραφήεικόναεικόναςενδοεπικοινωνίεςενισχυτέςεξοπλισμόςεξωτερικούεργαλείαζυγαριέςηλεκτρικάηλεκτρονικάηλιακάηλικιωμένουςηχείαθερμόμετρακάμερεςκάρτεςκαμερώνκαταγραφήςκαταγραφικάκατηγοριακινητάκινητόκινητώνκρυφέςλάμπεςλύσειςμίνιμαγειρικήςμασάζμετεωρολογικοίμηχανέςμηχανήςμνήμηςμπάνιουμπαταρίεςξενοδοχείωνοθόνηοικιακάομορφιάςπάνελπαιδιάπαιχνίδιαπισωποδήλαταπροσφορέςπροϊόνταρεύμαρολόγιασπιτιούσταθμοίσυμβουλέςσυμπληρώστεσυναγερμοίσυσκευέςσόμπεςσώματοςτηλέφωναυγείαςφακοίφακόςφορτιστέςφωτιστικάχειρόςχώρουόργανα
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Clevermarket | Gadgets & Έξυπνα Ηλεκτρονικά
H2 tags
Φορητή Συσκευή UV Αποστείρωσης - Φορητή - Λειτουργεί με 2 μπαταρίες ΑΑΑ
ΣΥΣΚΕΥΗ ΑΤΜΟΥ ΚΑΘΕΤΟΥ ΣΙΔΕΡΩΜΑΤΟΣ FG-528-15 TELCO 1500W ΜΠΛΕ – Πλάκα κεφαλής με ανοξείδωτο ατσάλι – Δοχείο νερού 350ml – Mήκος καλωδίου 1,8m – Παραγωγή ατμού σε 20-30 δευτ. – Ροή ατμού 30gr./λεπτό
Telco Multicooker™ – Πολυμάγειρας 5L / 900w με 11 διαφορετικές επιλογές μαγειρέματος – Ανοξείδωτο σώμα – Αποσπώμενο εσωτερικό δοχείο από αλουμίνιο με αντικολλητική επίστρωση – Οθόνη LCD
Αερόθερμο τοίχου τύπου κλιματιστικού με τηλεχειριστήριο χρήση και σαν ανεμιστήρας με οθόνη
Επαγγελματική Ηλεκτροκόλληση Inverter Telco – MMA 250 με Ρυθμιζόμενο Ρεύμα Συγκόλλησης 20 – 250 A + Θερμική Προστασία – Ανεμιστήρα – Υποδοχή για έως 2,5 Ηλεκτρόδιο – 4 χιλιοστά έλασμα συνεχόμενη ραφή
Smartwatch Ρολόι Κινητό χειρός Bluetooth Smartwatch σε μαύρο χρώμα OEM [Προσφορά Εβδομάδος]
Super Mini Κινητό με 2 κάρτες Sim μέγεθος όσο ο αντίχειρας και βάρος 60gr
Κινητό για Ηλικιωμένους με Ελληνικό Μενού - Μεγάλα Πλήκτρα - Κουμπί SOS - Άμεση Ειδοποίηση σε 10 αριθμούς - Ανοιχτή Ακρόαση - 2 Κάρτες SIM - Αυτονομία 10 Ημερών
CleverWifi™-Η Επαναστατική Κεραία WiFi Usb Ενίσχυσης Σήματος-Μεγάλης Απόστασης για Δωρεάν Internet/WIFI ΧΩΡΙΣ Πάγια με 10 μέτρα καλώδιο-σήμα έως 1000m μακριά-Εξωτερική-100% Αδιάβροχη- 2,4GHz+5GHz
Προτζέκτορας 600 Lumens - LED Projector HD με Ρυθμιστή Εστίασης FOCUS - Ενσωματωμένα Ηχεία για HOME CINEMA - Διαγώνιος οθόνης Προβολής 80 έως 152cm. - Υποδοχή για Κάρτα Μνήμης + USB Στικάκι
Mίνι φακός mini προβολέας led με zoom επαναφορτιζόμενος 800 MW - 500 Lumens - ο φακός των σωμάτων ασφαλείας - Απίστευτη απόδοση "κάνει την νύχτα μέρα" [HOT ΠΡΟΣΦΟΡΑ]
Φωτιστικό ασφαλείας επαναφορτιζόμενο με 72 LED εξαιρετικής φωτεινότητας
Ηλιακός προβολέας 20w IP 65 με Πάνελ 20w και τηλεχειριστήριο - Πανίσχυρος με 40 smd Led
Ηλιακό κιτ φωτισμού με 3 λάμπες + ραδιόφωνο - υποδοχή USB για μουσική - θύρα USB για φόρτιση - τηλεχειριστήριο + φορητός φακός
Φωτοβολταϊκό σέτ ολοκληρωμένο αποτελούμενο από 2 Πάνελ Χ 100 WATT - Ρυθμιστή φόρτισης 20 Am - Μπαταρία 12 VOLT 100 Amh - 6 Λάμπες οικονομίας
Γυαλιά ηλίου απορροφητικά HD Vision unisex + Γυαλιά νυχτερινής οδήγησης (σετ 2 τεμαχίων) - Φοριούνται και πάνω απο τα μυωπίας [ΠΡΟΣΦΟΡΑ ΕΒΔΟΜΑΔΟΣ]
Τζιν Κολάν - Caresse Jeans για καλοσχηματισμένη σιλουέτα
Γυαλιά οδήγησης με αισθητήρα αφύπνησης υπνηλίας + Φακός 3 LED για διάβασμα και πεζοπορία
Βεντούζες σετ 6 ανταλλακτικών κεφαλών παραδοσιακή αποτελεσματική θεραπεία (Δείτε σχετικό βίντεο)
Μεγεθυντικός φακός Α4 φορητός για ελεύθερα χέρια (διαστάσεων 27,50 Χ 20 cm)
Ελαστικό - Ορθοπεδικό γιλέκο στήριξης με ζώνη μέσης για σωστή στάση του σώματος και ανακούφιση από μυϊκούς πόνους
Ανδρικό φανελάκι ελαστικό για λεπτότερη σιλουέτα - Σύσφιξη κοιλιάς - Αδυνάτισμα (Δείτε σχετικό video)
Ζώνη μασάζ αδυνατίσματος με δόνηση vibratone - παθητικής γυμναστικής
Συσκευή Shiatsu μασάζ λαιμού, αυχένα, πλάτης με υπέρυθρη ακτινοβολία (Δείτε βίντεο)
CleverGun™ - Η Επαναστατική Συσκευή Μασάζ - 6 Κεφαλές - 20 Ταχυτήτων - Ψηφιακή Οθόνη - Θεραπεία πόνων - Βελτίωση κυκλοφορίας - Μοναδική Αίσθηση Μαλάξεων - Ενδυνάμωση Μυών
Θερμαινόμενη βούρτσα ισιώματος μαλλιών με ψηφιακή ρύθμιση θερμοκρασίας
Ακουστικά Βοήθημα Βαρηκοΐας - Ενίσχυσης Ακοής - Βιονικό αυτί για διακριτική ακρόαση
Clever Scale™ – Ζυγαριά με Bluetooth και θερμόμετρο χώρου – Σύνδεση με εφαρμογή στο κινητό (Android/Iphone) – Διατήρηση Ιστορικού – Πολλαπλές βιομετρικές μετρήσεις – ΒΜΙ, Λιπομέτρηση, Μυϊκή μάζα, κτλ.
Ηλεκτρική χτένα για ψείρες - Αντιφθειρικό ηλεκτρικό χτενάκι για παιδιά - κατοικίδια
Clever Blood Monitor™ – Υπεραυτόματο Πιεσόμετρο Μπράτσου με Ελληνική εκφώνηση – Ειδοποίηση υψηλής χαμηλής πίεσης με ηχητική εκφώνηση – 99 μνήμες – 2 ξεχωριστά προφίλ
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test74% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test25% of top 100 sites passed
  • This webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test28% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test8% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test41% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Social Media Test57% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook 
Speed optimizations
Score: 64
Failed: 7
Warnings: 3
Passed: 15
HTML Page Size Test21% of top 100 sites passed
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 3,675 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 406.1 Kb to 77.5 Kb (81% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 6.26 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
59.6 %
1.44 Mb
image
25.8 %
638.18 Kb
font
7.5 %
185.82 Kb
html
3.4 %
83.76 Kb
css
2.6 %
63.31 Kb
other
1.1 %
27.88 Kb
TOTAL
100%
2.41 Mb
Requests by content type
Content type
Percent
Requests
javascript
35.8 %
44
image
35.8 %
44
other
10.6 %
13
font
9.8 %
12
css
4.9 %
6
html
3.3 %
4
TOTAL
100%
123
Content size by domain
Domain
Percent
Size
static.clevermarket.gr
23.9 %
591.41 Kb
clevermarket.gr
17.6 %
434.75 Kb
googletagmanager.com
10.5 %
258.57 Kb
static.xx.fbcdn.net
9.9 %
244.93 Kb
gstatic.com
8.3 %
205.41 Kb
scripts.bestprice.gr
7.8 %
192.30 Kb
fonts.gstatic.com
7.7 %
189.61 Kb
connect.facebook.net
6.5 %
160.65 Kb
translate.googleapis.com
3.0 %
73.78 Kb
translate.google.com
1.2 %
30.56 Kb
Other
3.7 %
90.72 Kb
TOTAL
100%
2.41 Mb
Requests by domain
Domain
Percent
Requests
static.clevermarket.gr
25.2 %
31
clevermarket.gr
17.9 %
22
fonts.gstatic.com
10.6 %
13
static.xx.fbcdn.net
8.9 %
11
scripts.bestprice.gr
7.3 %
9
google-analytics.com
4.1 %
5
google.com
3.3 %
4
connect.facebook.net
3.3 %
4
googletagmanager.com
2.4 %
3
gstatic.com
2.4 %
3
Other
14.6 %
18
TOTAL
100%
123
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test97% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test97% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test96% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test98% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 1.780 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

1.78 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 2.914 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

2.914 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 3.36 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

3.36 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img src="//static.clevermarket.gr/uploads/images/109366/tsi..." alt="">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0427. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0427

0.1

0.25

DOM element which contributes the most to CLS score:
Text: ΔΕΙΤΕ ΕΔΩ ΔΕΙΤΕ ΕΔΩ ΔΕΙΤΕ ΕΔΩ ΑΓΟΡΑ ΑΓΟΡΑ ΑΓΟΡΑ ΔΗΜΟΦΙΛΗ TELEMARKETING Φορητ...
Html: <div class="home-region home-page">
Score: 0.0398
Server and security
Score: 90
Failed: 2
Warnings: 0
Passed: 8
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.clevermarket.gr" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
clevermarket.gr
Subject Alternative Names (SANs)
*.clevermarket.gr, clevermarket.gr
Not valid before
Wed, February 14o 2024, 10:46:45 pm (z)
Not valid after
Tue, May 14o 2024, 10:46:44 pm (z)
Signature algorithm
ecdsaWithSha384
Issuer
E1
Intermediate certificate
Common name
E1
Organization
Let's Encrypt
Location
US
Not valid before
Fri, September 4o 2020, 12:00:00 am (z)
Not valid after
Mon, September 15o 2025, 4:00:00 pm (z)
Signature algorithm
ecdsaWithSha384
Issuer
ISRG Root X2
Intermediate certificate
Common name
ISRG Root X2
Organization
Internet Security Research Group
Location
US
Not valid before
Fri, September 4o 2020, 12:00:00 am (z)
Not valid after
Mon, September 15o 2025, 4:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test82% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000; includesubdomains
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test98% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test100% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 35
Failed: 3
Warnings: 0
Passed: 7
Structured Data Test53% of top 100 sites passed
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.clevermarket.gr/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.clevermarket.gr/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:spf.protection.outlook.com include:spf.lighthouse.gr -all
Ads.txt Validation Test68% of top 100 sites passed
  • The access to the ads.txt file is restricted! Our request for this resource has returned a {status_code} HTTP status code. In order for this resource to be easily accessed by the DSPs and advertisers, its status code should be 200 OK.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved