seo site checkup logo
PricingFree ToolsArticles
Report generated a month ago
https://www.cha.nl
Your general SEO Checkup Score
Archived
60/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 60 out of 100, which is below the average score of 75. However, there are 19 SEO issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
19 Failed
4 Warnings
38 Passed
Issues to fix
HIGH
Add a descriptive and relevant title tag to the webpage, targeting important keywords or phrases, as a missing or poor title tag can make it difficult for the page to rank well in search engines.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
Add a meta description tag to provide a brief and informative summary of the page's content for search engines.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
MEDIUM
Using social media meta tags can improve the appearance and content of shared links on social media platforms, potentially increasing click-through rates and engagement with the page.
MEDIUM
HTTP/2 protocol offers several key improvements, including faster page load times, improved performance, better security and more efficient use of network resources.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Consider reducing the HTML size to improve loading times and retain visitors.
LOW
Enable HTML compression to reduce page size and loading times.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
Common SEO issues
Score: 46
Failed: 8
Warnings: 0
Passed: 14
Meta Title Test100% of top 100 sites passed
  • This webpage is not using a title tag! A missing or poor title tag (that does not target important keywords or phrases) will make it difficult for your page to rank well in search engines.
Meta Description Test92% of top 100 sites passed
  • This webpage is not using a meta description tag! You should include this tag in order to provide a brief description of your page which can be used by search engines. Well-written and inviting meta descriptions may also help click-through rates to your site in search engine results.
Google Search Results Preview Test
Desktop version
https://www.cha.nl/
Mobile version
https://www.cha.nl/
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
14voor6technische6meer6onze5beheer
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
voor
technische
meer
onze
beheer
Keywords Cloud Test
aangevraagdaanvullendeabonneeactiefadministratiealleenaltijdandereanoniemeapothekersbeheerbekijkbestebetekenenclearingcommunicatiecommunicatienetwerkcontactcookiecookiebeleidcookiesdagvaardingdeclaratieprocesderdedienstdisclaimerdoeldoeleindendoorelektronischenigfunctioneelgebruikgebruikengebruikergebruiktgegevensgemakgeselecteerdegespecificeerdgevraagdgewoonlijkgraagheefthelpenhomehouseinfomedicsinformatieinternetkunnenlegitiememakenmarketingmeermogelijknalevingneemnietnodignoodzakelijkonlineonzeopgehaaldopgeslagenoplossingopslagpartijpartijenprivacyproviderserviceservicedeskslaansoortgelijkespecifiekestatementstatistiekenstatistischestrikttechnischetechnologieëntijdtoegangtoestaantoestemmingtransmissieuitdrukkelijkuitsluitenduitvoeringvoorvoorkeurenvrijwilligewaaromwiltwordtzijnzoalszonderzorg
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 61
Failed: 6
Warnings: 3
Passed: 11
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 231 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage doesn't use HTML compression! We recommend to compress the HTML code in order to reduce the page size and page loading times - this will help a website to retain visitors and increase page views. If the HTML compression will be enabled, the HTML size will be decreased by 73% - from 54.96 Kb to 14.68 Kb .
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 5.32 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
54.8 %
2.00 Mb
javascript
20.3 %
757.13 Kb
font
17.3 %
644.96 Kb
css
6.1 %
226.70 Kb
html
1.5 %
55.49 Kb
other
0.1 %
3.31 Kb
TOTAL
100%
3.65 Mb
Requests by content type
Content type
Percent
Requests
other
29.2 %
14
javascript
25.0 %
12
image
20.8 %
10
css
14.6 %
7
font
8.3 %
4
html
2.1 %
1
TOTAL
100%
48
Content size by domain
Domain
Percent
Size
cha.nl
92.8 %
3.38 Mb
googletagmanager.com
6.4 %
239.09 Kb
cdn.infisecure.com
0.5 %
19.18 Kb
fd.cleantalk.org
0.3 %
10.43 Kb
prod.ap.batic.cudasvc.com
0.0 %
1.52 Kb
monitor.infisecure.com
0.0 %
141 B
TOTAL
100%
3.65 Mb
Requests by domain
Domain
Percent
Requests
cha.nl
62.5 %
30
prod.ap.batic.cudasvc.com
20.8 %
10
cdn.infisecure.com
4.2 %
2
googletagmanager.com
4.2 %
2
monitor.infisecure.com
4.2 %
2
fd.cleantalk.org
4.2 %
2
TOTAL
100%
48
CDN Usage Test95% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is not using cache headers for all JavaScript resources! Setting cache headers can help to speed up the webpage for returning users.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.510 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.51 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 2.413 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

2.413 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 0.0 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.
0
Largest Contentful Paint element within the viewport:
<video src="https://www.cha.nl/wp-content/themes/CHA/assets/im..." class="w-full h-full object-cover" muted="" loop="" playsinline="">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0016. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0016

0.1

0.25

DOM element which contributes the most to CLS score:
Html:
Score: 0.0016
Server and security
Score: 79
Failed: 3
Warnings: 0
Passed: 4
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.cha.nl" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
cha.nl
Subject Alternative Names (SANs)
cha.nl, www.cha.nl, clearinghouseapothekers.nl, www.clearinghouseapothekers.nl, clearinghouseapothekers.com, www.clearinghouseapothekers.com, diensten.cha.nl
Not valid before
Wed, January 8o 2025, 12:00:00 am (z)
Not valid after
Wed, January 7o 2026, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Trust Provider B.V. TLS RSA CA G1
Intermediate certificate
Common name
Trust Provider B.V. TLS RSA CA G1
Organization
Trust Provider B.V.
Location
NL
Not valid before
Thu, November 2o 2017, 12:25:10 pm (z)
Not valid after
Tue, November 2o 2027, 12:25:10 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
DigiCert Global Root G2
Root certificate
Common name
DigiCert Global Root G2
Organization
DigiCert Inc
Location
US
Not valid before
Thu, August 1o 2013, 12:00:00 pm (z)
Not valid after
Fri, January 15o 2038, 12:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
DigiCert Global Root G2
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is not using the HTTP/2 protocol!
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000; includesubdomains; preload
Plaintext Emails Test97% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 74
Failed: 2
Warnings: 1
Passed: 6
Structured Data Test66% of top 100 sites passed
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 a ip4:95.142.105.11 ip4:95.142.105.12 ip4:23.90.116.240 ip4:23.90.111.239 include:servers.mcsv.net include:_spf.twikey.com ip4:84.252.124.98 include:spf.mandrillapp.com include:_spf.eu.sparkpostmail.com include:de._netblocks.mimecast.com -all
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved