seo site checkup logo
PricingFree ToolsArticles
Report generated 2 days ago
https://www.catchandrelease.com
Your general SEO Checkup Score
Archived
68/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 68 out of 100, which is below the average score of 75. However, there are 15 SEO issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
15 Failed
3 Warnings
43 Passed
Issues to fix
HIGH
To provide a good user experience, Google recommends that sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
MEDIUM
Reducing the JavaScript execution time can result in faster page load times and a smoother user experience, as it allows the browser to render and display the page more quickly.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Consider reducing the HTML size to improve loading times and retain visitors.
LOW
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
Common SEO issues
Score: 68
Failed: 4
Warnings: 3
Passed: 15
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Digital Content Licensing | UGC Creator Platform
Length: 48 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 130 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Discovering the potential of Found Content to turn social media moments into high-performing ads–fast, legal, and creator approved
Length: 130 characters
Google Search Results Preview Test
Desktop version
https://www.catchandrelease.com/Digital Content Licensing | UGC Creator PlatformDiscovering the potential of Found Content to turn social media moments into high-performing ads–fast, legal, and creator approved
Mobile version
https://www.catchandrelease.com/Digital Content Licensing | UGC Creator PlatformDiscovering the potential of Found Content to turn social media moments into high-performing ads–fast, legal, and creator approved
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:title
Digital Content Licensing | UGC Creator Platform
og:description
Discovering the potential of Found Content to turn social media moments into high-performing ads–fast, legal, and creator approved
og:image
https://cdn.prod.website-files.com/66e20c9d961babf20c468442/67589bda57962fb30fba8a7b_Open%20Graph%20OPT1.webp
og:type
website
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
21content13licensing10license10catch10release
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
content
licensing
license
catch
release
Keywords Cloud Test
agencyarchivalassetsauthenticbestbowlbrandbudgetcampaigncarecatchcelebritiescinematiccollectconsumercontentcookiescreatecreativescreatorcreatorscuratecurationcustomerdeclinediveeventsexpertfarmerfastfeaturesformfreegatoradegeniegoodshelphelpingholidaysinformationitemkindlearnlicensablelicenselicensingmanagedmarketplacemediamilkneedofferoopsoptionoriginaloverviewpackagedpetspharmaplatformpolicypricingprivacyprocessproductionprofitprojectspublixreaderrealreceivedreleaserememberretailrightsscreensearchservicessocialsportsstartstartedstoriessubmissionsubmittingsuccesssupersupporttalkteamthanktiktoktimetrackedupdateusedwebsitewentworkwrong
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Real fast.
Found the perfect shot on YouTube, Instagram, or TikTok?
You can license it, legally and in hours with Catch+Release.
H2 tags
Let's chat
Create with culture
You may now license the internet.
Customer Work
Made with Found Content
Real Customer Love
A Platform Built for Speed
No platform fee
Free to curate and collaborate
Our services
Fresh finds. Fast.
Get hooked on our newsletter
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test27% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
meta charset="utf-8"
Speed optimizations
Score: 62
Failed: 7
Warnings: 0
Passed: 13
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 3,466 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 1281.92 Kb to 683.15 Kb (47% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 8.8 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 3.5 seconds! When the JavaScript code takes a long time to execute, it slows down the page performance in several ways: longer download times, main thread bottlenecks, delays of "Time To Interactive", memory leaks, etc.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
other
59.1 %
12.20 Mb
html
28.1 %
5.80 Mb
javascript
10.0 %
2.06 Mb
image
2.5 %
528.90 Kb
css
0.4 %
76.87 Kb
font
0.0 %
0 B
TOTAL
100%
20.65 Mb
Requests by content type
Content type
Percent
Requests
html
46.4 %
121
javascript
19.9 %
52
other
16.1 %
42
image
15.7 %
41
css
1.9 %
5
font
0.0 %
0
TOTAL
100%
261
Content size by domain
Domain
Percent
Size
vod-adaptive-ak.vimeocdn.com
56.8 %
11.73 Mb
catchandrelease.com
27.4 %
5.66 Mb
cdn.prod.website-files.com
5.5 %
1.13 Mb
googletagmanager.com
2.1 %
437.24 Kb
js.intercomcdn.com
1.6 %
327.80 Kb
f.vimeocdn.com
1.3 %
273.86 Kb
acsbapp.com
1.0 %
218.20 Kb
analytics.tiktok.com
0.7 %
146.09 Kb
connect.facebook.net
0.7 %
142.65 Kb
cdn.embedly.com
0.5 %
99.46 Kb
Other
2.6 %
544.02 Kb
TOTAL
100%
20.65 Mb
Requests by domain
Domain
Percent
Requests
catchandrelease.com
44.4 %
116
cdn.prod.website-files.com
14.9 %
39
cdn.jsdelivr.net
3.8 %
10
vod-adaptive-ak.vimeocdn.com
3.4 %
9
analytics.tiktok.com
2.7 %
7
alb.reddit.com
2.3 %
6
arclight.vimeo.com
2.3 %
6
googletagmanager.com
1.5 %
4
f.vimeocdn.com
1.5 %
4
joinamply.github.io
1.1 %
3
Other
21.8 %
57
TOTAL
100%
261
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.350 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.35 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 1.124 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

1.124 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 4.34 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

4.34 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img src="https://cdn.prod.website-files.com/66e20c9d961babf..." loading="lazy" alt="" sizes="(max-width: 1920px) 100vw, 1920px" srcset="https://cdn.prod.website-files.com/66e20c9d961babf..." class="image-absolute">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0015. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0015

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Found the perfect shot on YouTube, Instagram, or TikTok? You can license it, leg...
Html: <div class="section-title_title-wrap max-width-xxxlarge">
Score: 0.0015
Server and security
Score: 89
Failed: 1
Warnings: 0
Passed: 6
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.catchandrelease.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.catchandrelease.com
Subject Alternative Names (SANs)
*.catchandrelease.com, catchandrelease.com
Not valid before
Wed, December 10o 2025, 12:00:00 am (z)
Not valid after
Fri, January 8o 2027, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Amazon RSA 2048 M04
Intermediate certificate
Common name
Amazon RSA 2048 M04
Organization
Amazon
Location
US
Not valid before
Tue, August 23o 2022, 10:26:35 pm (z)
Not valid after
Fri, August 23o 2030, 10:26:35 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Amazon Root CA 1
Root certificate
Common name
Amazon Root CA 1
Organization
Amazon
Location
US
Not valid before
Tue, May 26o 2015, 12:00:00 am (z)
Not valid after
Sun, January 17o 2038, 12:00:00 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Amazon Root CA 1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=63072000; includesubdomains
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 43
Failed: 3
Warnings: 0
Passed: 6
Structured Data Test66% of top 100 sites passed
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.catchandrelease.com/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.catchandrelease.com" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:_spf.google.com include:4657307.spf06.hubspotemail.net include:spf.tapfiliate.com include:sendgrid.net -all
Ads.txt Validation Test67% of top 100 sites passed
  • The request of ads.txt file has an unexpected Content-Type header: text/html; charset=UTF-8. In order for this resource to be easily accessed by the DSPs and advertisers, its Content-Type header should be text/plain or text/plain; charset=utf-8.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved