seo site checkup logo
PricingFree ToolsArticles
Report generated 5 years ago
https://www.brandhk.gov.hk/html/en
Your general SEO Checkup Score
Archived
81/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 81 out of 100, which is higher than the average score of 75. Our analysis has identified 10 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
10 Failed
2 Warnings
40 Passed
Common SEO issues
Score: 91
Failed: 2
Warnings: 1
Passed: 17
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: Brand Hong Kong (BrandHK) | Asia's World City
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: Brand Hong Kong (BrandHK) promotes Hong Kong as a free and dynamic society where creativity and entrepreneurship converge.
Google Search Results Preview Test
Desktop version
https://www.brandhk.gov.hk/html/enBrand Hong Kong (BrandHK) | Asia's World CityBrand Hong Kong (BrandHK) promotes Hong Kong as a free and dynamic society where creativity and entrepreneurship converge.
Mobile version
https://www.brandhk.gov.hk/html/enBrand Hong Kong (BrandHK) | Asia's World CityBrand Hong Kong (BrandHK) promotes Hong Kong as a free and dynamic society where creativity and entrepreneurship converge.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
45hong45kong20brand12html10covid
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
admissionadvantagesadvisoriesareaasiabeltbrandbrandhkbrandingbusinesscampaignscityclassclimatecolorconnectconnectedcontactcornercovidculturedefaultdesigneducationencodingentryeventsevolutionexcelfacebookfacesfactfaqsfestivalsfightfilmfinancialfocusfollowfontsgreatergreenguidelinesheritagehksarhomehonghtmlhttpimageinfrastructureinitiativeinnovationinstagramknowledgekonglatestlegalleisurelibraryloosemediamultimedianationalpostersprofessionalpublicpublicationsquarantinereadregionalresponseroadsafesecuresecurityservicessheetssizesocialstagestoriesstrategicstudyingsubscribetalenttechnologytrainingtransitionaltravellerstriviatweetsupdatevideosvisitingwallpapersweekwelcomesworldyoutube
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Congratulations! Your webpage contains headings tags.
H1 tags
Brand Hong Kong (BrandHK) | Asia's World City
H2 tags
Response to COVID-19
National Security Law for the HKSAR
The Fight Against COVID-19
Robots.txt Test
  • This website is using a robots.txt file.
SEO Friendly URL Test
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test
  • We found some HTML deprecated tags. You are advised to change these old tags with equivalent tags or proper CSS rules.
1font
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Social Media Test
  • Congratulations! Your website is connected successfully with social media using:
AddThisĀ FacebookĀ Google PlusĀ TwitterĀ 
Speed optimizations
Score: 68
Failed: 4
Warnings: 1
Passed: 11
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 198.2 Kb to 58.47 Kb (70% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 4.24 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Total Objects: 172
  • 5 HTML Pages
  • 20 CSS Files
  • 70 JS Files
  • 77 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test
  • Your webpage is serving all images, javascript and css resources from CDNs.
See results list
Image Caching Test
  • Congratulations! Your website is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Caching Test
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test
  • Congratulations! Your website is using cache headers for all CSS resources.
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Some of your webpage's CSS resources are not minified.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test
  • Your URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 77
Failed: 1
Warnings: 0
Passed: 5
URL Canonicalization Test
HTTPS Test
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 61
Failed: 3
Warnings: 0
Passed: 5
Structured Data Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Custom 404 Error Page Test
  • Congratulations, your website is using a custom 404 error page. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://www.brandhk.gov.hk/html/en/index.html should be the preferred version of this page. The canonical tag can be useful when there are similar versions of the same content on several URLs (e.g., such as e-commerce sites where URL modifiers like sort parameters are appended to a product page's URL). Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.brandhk.gov.hk/html/en/index.html" rel="canonical"/>
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF Records Test
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved