seo site checkup logo
PricingFree ToolsArticles
Report generated 7 months ago
https://www.bitiba.co.uk/shop/cats/dry_cat_food
Your general SEO Checkup Score
Archived
73/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 73 out of 100, which is below the average score of 75. However, there are 15 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
15 Failed
5 Warnings
53 Passed
Issues to fix
HIGH
To provide a good user experience, Google recommends that sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.
HIGH
It is recommended to avoid URL parameters and to use hyphens to separate words in the URL structure, rather than underscores.
HIGH
Connect your webpage with social media networks using APIs or AddThis, as social signals are becoming increasingly important for search engines to validate a site's trustworthiness and authority.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 66
Failed: 5
Warnings: 3
Passed: 17
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Dry Cat Food | Buy at lowest prices at bitiba.co.uk %
Length: 53 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 137 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Dry Cat Food – Discover our wide range of products and attractive offers ✓ Get £4 off your first order over £39 ✓ Free delivery from £45
Length: 137 characters
Google Search Results Preview Test
Desktop version
https://www.bitiba.co.uk/shop/cats/dry_cat_foodDry Cat Food | Buy at lowest prices at bitiba.co.uk %Dry Cat Food – Discover our wide range of products and attractive offers ✓ Get £4 off your first order over £39 ✓ Free delivery from £45
Mobile version
https://www.bitiba.co.uk/shop/cats/dry_cat_foodDry Cat Food | Buy at lowest prices at bitiba.co.uk %Dry Cat Food – Discover our wide range of products and attractive offers ✓ Get £4 off your first order over £39 ✓ Free delivery from £45
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:description
Dry Cat Food – Discover our wide range of products and attractive offers ✓ Get £4 off your first order over £39 ✓ Free delivery from £45
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
144food41individually41priced38adult31cookies
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
food
individually
priced
adult
cookies
Keywords Cloud Test
accountadultadvanceaffinityapplawsavailablebalancedbestbitibabreedcanincarecategorycatschickencompleteconceptcontentcookiesdaysdeliciousdeliverydietdietsdifferentenrichedeukanubafarmfeedingfelineferingafishfoodfoodsfreefreedomfreshgrainhelphighhilliamsindividuallyjameskibblekittenlabellargelifelittermainemeatmenumultibuynotifynutritionaloffersopenorderphotosplanpoultrypremiumprescriptionpricepricedproductsproteinprovidepurinapurizonqualityratedratingreciperosieroyalsavescienceseniorsensitivesmallsmillasoldsterilisedstoresupplementssuppliestastytimetoysturkeyvarietiesveterinaryviewwebsiteweightwellbelovedwildworking
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Dry Cat Food
H2 tags
Concept for Life All Cats
Feringa Kitten Classic Poultry
Feringa Adult Classic Turkey
Feringa Adult Sterilised Salmon
Feringa Adult Duo Chicken with Trout
Feringa Adult Classic Duck
Feringa Adult Cold-Pressed Chicken
Concept for Life Multibuys
Feringa Senior Chicken
Feringa Adult Duo Chicken with Lamb
Feringa Adult Cold-Pressed Turkey
Eukanuba Top Condition 7+ Senior
Feringa Sterilised Poultry
Wild Freedom Adult "Wide Country" Poultry - Grain-free
Smilla Kitten Poultry
Concept for Life Maine Coon Adult
Wild Freedom Adult Dry Cat Food Mixed Trial Packs
Smilla Adult Poultry
IAMS for Vitality Adult Fresh Chicken Dry Cat Food
Smilla Adult Sensitive - Grain-Free Poultry
Concept for Life Maine Coon Kitten
Purizon Adult Sterilised Grain-Free Chicken & Fish
Purizon Grain-Free Dry Cat Food Multibuys
PURINA ONE Adult Chicken & Whole Grains Dry Cat Food
We recommend the following dry cat food brands
More quality dry cat food from pet specialists
Supermarket - economical dry cat food
Dry food for cats – high-quality and balanced
How much dry cat food per day?
Can you mix dry food for cats with water?
How long can dry cat food be left standing?
Which dry cat food is the best?
Haven't found what you're looking for?
Help and Contact
Shopping
Advantages
Help us improve Bitiba!
Privacy Preference Centre
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
SEO Friendly URL Test25% of top 100 sites passed
  • This webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test28% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test8% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test41% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Social Media Test57% of top 100 sites passed
  • This webpage is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 68
Failed: 7
Warnings: 1
Passed: 17
HTML Page Size Test21% of top 100 sites passed
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 6,829 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 2002.38 Kb to 169.66 Kb (92% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 8.42 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 2 seconds!
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
62.8 %
684.12 Kb
html
12.9 %
139.95 Kb
image
8.0 %
86.79 Kb
css
7.4 %
80.04 Kb
other
5.1 %
55.75 Kb
font
3.9 %
41.96 Kb
TOTAL
100%
1.06 Mb
Requests by content type
Content type
Percent
Requests
javascript
29.2 %
26
image
25.8 %
23
other
24.7 %
22
css
11.2 %
10
html
6.7 %
6
font
2.2 %
2
TOTAL
100%
89
Content size by domain
Domain
Percent
Size
bitiba.co.uk
67.0 %
728.89 Kb
cdn.cookielaw.org
15.6 %
169.36 Kb
cdn.public.zooplus.net
8.4 %
90.99 Kb
images.ctfassets.net
5.3 %
58.13 Kb
media.zooplus.com
1.1 %
12.22 Kb
uxt-components-prod.public.zooplus.net
0.7 %
7.48 Kb
content-bff.public.zooplus.net
0.6 %
6.14 Kb
login.bitiba.co.uk
0.4 %
4.84 Kb
mkt-tech.omt-services.com
0.3 %
3.42 Kb
cdn-prod.shphdrp.ext.aws.zooplus.io
0.3 %
3.38 Kb
Other
0.3 %
3.75 Kb
TOTAL
100%
1.06 Mb
Requests by domain
Domain
Percent
Requests
bitiba.co.uk
36.0 %
32
images.ctfassets.net
14.6 %
13
cdn.public.zooplus.net
12.4 %
11
cdn.cookielaw.org
11.2 %
10
content-bff.public.zooplus.net
6.7 %
6
login.bitiba.co.uk
4.5 %
4
media.zooplus.com
3.4 %
3
o354215.ingest.sentry.io
2.2 %
2
content-bff.cmsp.ext.aws.zooplus.io
2.2 %
2
cdn-dev.public.zooplus.net
2.2 %
2
Other
4.5 %
4
TOTAL
100%
89
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test97% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test97% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test96% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test98% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.069 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.069 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 1.148 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

1.148 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 9.75 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

9.75 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: We use cookies, pixels and other technologies ("cookies") on our website. We use...
Html: <div id="onetrust-policy-text">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0429. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0429

0.1

0.25

DOM element which contributes the most to CLS score:
Text: More photos (6) Concept for Life All Cats Not rated Premium dry food for adult...
Html: <div class="ProductListItem_productRow__9B_By">
Score: 0.0426
Server and security
Score: 97
Failed: 1
Warnings: 0
Passed: 9
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.bitiba.co.uk" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
bitiba.co.uk
Subject Alternative Names (SANs)
bitiba.co.uk, *.bitiba.co.uk
Not valid before
Fri, May 17o 2024, 12:00:00 am (z)
Not valid after
Mon, June 16o 2025, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Amazon RSA 2048 M02
Intermediate certificate
Common name
Amazon RSA 2048 M02
Organization
Amazon
Location
US
Not valid before
Tue, August 23o 2022, 10:25:30 pm (z)
Not valid after
Fri, August 23o 2030, 10:25:30 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Amazon Root CA 1
Root certificate
Common name
Amazon Root CA 1
Organization
Amazon
Location
US
Not valid before
Tue, May 26o 2015, 12:00:00 am (z)
Not valid after
Sun, January 17o 2038, 12:00:00 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Amazon Root CA 1
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test82% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test98% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test100% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0, maximum-scale=2" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 67
Failed: 2
Warnings: 1
Passed: 7
Structured Data Test53% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.bitiba.co.uk/shop/cats/dry_cat_food is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.bitiba.co.uk/shop/cats/dry_cat_food" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 ip4:62.209.48.170/32 include:spf.protection.outlook.com include:amazonses.com include:spf.mailjet.com include:fdspfeuc.freshemail.io include:sendgrid.net -all
Ads.txt Validation Test68% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved