seo site checkup logo
PricingFree ToolsArticles
Report generated 13 days ago
https://www.bing.com
Your general SEO Checkup Score
Archived
68/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 68 out of 100, which is below the average score of 75. However, there are 17 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
17 Failed
2 Warnings
53 Passed
Issues to fix
HIGH
It is recommended to avoid URL parameters and to use hyphens to separate words in the URL structure, rather than underscores.
HIGH
To address URL canonicalization issues, it is recommended to select a primary URL for your webpage and set up redirects from all other variations to the preferred one.
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
HIGH
Connect your webpage with social media networks using APIs or AddThis, as social signals are becoming increasingly important for search engines to validate a site's trustworthiness and authority.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
Reducing the JavaScript execution time can result in faster page load times and a smoother user experience, as it allows the browser to render and display the page more quickly.
MEDIUM
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
Common SEO issues
Score: 55
Failed: 7
Warnings: 2
Passed: 16
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Search - Microsoft Bing
Length: 23 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Search with Microsoft Bing and use the power of AI to find information, explore webpages, images, videos, maps, and more. A smart search engine for the forever curious.
Length: 168 characters
Google Search Results Preview Test
Desktop version
https://www.bing.com/Search - Microsoft BingSearch with Microsoft Bing and use the power of AI to find information, explore webpages, images, videos, maps, and more. A smart search engine for the forever curious.
Mobile version
https://www.bing.com/Search - Microsoft BingSearch with Microsoft Bing and use the power of AI to find information, explore webpages, images, videos, maps, and more. A smart search engine for the forever curious.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:type
website
og:title
Painted clouds, still cliffs
og:image
https://www.bing.com/th?id=OHR.ScottsBluff_EN-US3893566724_tmb.jpg&rf=
og:image:width
1366
og:image:height
768
og:url
https://www.bing.com/?form=HPFBBK&ssd=20250831_0700&mkt=en-US
og:site_name
Search - Microsoft Bing
og:description
Long before GPS, natural landmarks like Scotts Blu
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
5search4images4bing4image4privacy
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
search
images
bing
image
privacy
Keywords Cloud Test
andriyannouncesappalachianbingbluffbrowserbuckmancalendarcaliforniacameracheckchicagocliffscloudscopilotcourtcrestdeaddifferentdragdropenableexcelfeedbackfindsgamesgeringgettyhawkhelphomepagehttphttpsidentifyimageimagesimprovekeywordsknowlinkmapsmayormicrosoftmobilemonumentmormonnationalnavigatenebraskanewsobjectsonedriveonenoteonlineopenorderoregonoutlookpacificpaintedparubiypeoplephotospioneerspolicypowerpointprivacyproblemsprocessprocessingprovidedquizrewardsroutescottssearchservicesshoppingshotsignsignssolvestartstartsswaytariffstermstexttrailtrailstranslateunableunlawfuluploadusedusingvideosvisualwallpaperword
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
Painted clouds, still cliffs
Court finds tariffs unlawful
Andriy Parubiy shot dead
Chicago mayor signs order
To sail to Gaza
Skin cancer scar revealed
Attendee found dead
Bat sells for nearly $10K
Former WH reporter dies
Influenced mass shooting?
Tropical Storm Kiko forms
Ex-mayor injured in NH
3 killed in Pontiac crash
AG Bondi fires DOJ staffer
Lin announces retirement
Florida State stuns Alabama
SSA chief data officer quits
Fierceness beats Journalism
Announces VOA layoffs
Israeli airstrike kills PM
Fastest Pacific row record
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
SEO Friendly URL Test29% of top 100 sites passed
  • This webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test10% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test27% of top 100 sites passed
  • This webpage has some warnings caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Social Media Test75% of top 100 sites passed
  • This webpage is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 75
Failed: 6
Warnings: 0
Passed: 19
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,672 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 264.38 Kb to 75.74 Kb (71% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 0.41 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 3.5 seconds! When the JavaScript code takes a long time to execute, it slows down the page performance in several ways: longer download times, main thread bottlenecks, delays of "Time To Interactive", memory leaks, etc.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
45.3 %
1.93 Mb
javascript
42.7 %
1.82 Mb
other
7.3 %
317.73 Kb
css
3.2 %
137.19 Kb
html
1.5 %
67.07 Kb
font
0.0 %
0 B
TOTAL
100%
4.25 Mb
Requests by content type
Content type
Percent
Requests
image
46.6 %
108
javascript
31.0 %
72
other
15.1 %
35
html
3.9 %
9
css
3.4 %
8
font
0.0 %
0
TOTAL
100%
232
Content size by domain
Domain
Percent
Size
assets.msn.com
38.9 %
1.65 Mb
bing.com
32.6 %
1.39 Mb
th.bing.com
15.1 %
656.55 Kb
r.bing.com
12.2 %
532.65 Kb
img-s-msn-com.akamaized.net
0.4 %
17.96 Kb
srtb.msn.com
0.4 %
15.39 Kb
msn.com
0.2 %
6.63 Kb
browser.events.data.msn.com
0.1 %
3.37 Kb
login.live.com
0.1 %
3.35 Kb
ib.adnxs.com
0.0 %
1.02 Kb
Other
0.1 %
2.87 Kb
TOTAL
100%
4.25 Mb
Requests by domain
Domain
Percent
Requests
bing.com
28.4 %
66
assets.msn.com
24.6 %
57
r.bing.com
21.1 %
49
img-s-msn-com.akamaized.net
7.3 %
17
th.bing.com
6.9 %
16
browser.events.data.msn.com
4.3 %
10
srtb.msn.com
3.9 %
9
msn.com
0.4 %
1
c.msn.com
0.4 %
1
px.ads.linkedin.com
0.4 %
1
Other
2.2 %
5
TOTAL
100%
232
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test100% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.030 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.03 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 0.894 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

0.894 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 1.76 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.76 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<div class="hp_top_cover" id="hp_top_cover" style="display: block; background-image: url("blob:https:...">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0551. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0551

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Bing homepage quiz What route did Scotts Bluff help pioneers navigate? AAppalach...
Html: <div class="vs_cont" id="vs_cont">
Score: 0.0551
Server and security
Score: 83
Failed: 1
Warnings: 0
Passed: 9
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.bing.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
r.bing.com
Organization
Microsoft Corporation
Location
Redmond, WA, US
Subject Alternative Names (SANs)
*.bing.com, *.bingstatic.com, *.explicit.bing.net, *.mm.bing.net, akam.bing.com, r.bing.com, r.msftstatic.com, raka.bing.com, raka.msftstatic.com, th.bing.com, th.msftstatic.com, thaka.bing.com, thaka.msftstatic.com
Not valid before
Wed, April 23o 2025, 4:55:40 pm (z)
Not valid after
Sat, April 18o 2026, 4:55:40 pm (z)
Signature algorithm
ecdsaWithSha384
Issuer
Microsoft Azure ECC TLS Issuing CA 04
Intermediate certificate
Common name
Microsoft Azure ECC TLS Issuing CA 04
Organization
Microsoft Corporation
Location
US
Not valid before
Thu, June 8o 2023, 12:00:00 am (z)
Not valid after
Tue, August 25o 2026, 11:59:59 pm (z)
Signature algorithm
ecdsaWithSha384
Issuer
DigiCert Global Root G3
Root certificate
Common name
DigiCert Global Root G3
Organization
DigiCert Inc
Location
US
Not valid before
Thu, August 1o 2013, 12:00:00 pm (z)
Not valid after
Fri, January 15o 2038, 12:00:00 pm (z)
Signature algorithm
ecdsaWithSha384
Issuer
DigiCert Global Root G3
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000; includesubdomains; preload
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test95% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 35
Failed: 3
Warnings: 0
Passed: 6
Structured Data Test66% of top 100 sites passed
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.bing.com/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.bing.com/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:spf.protection.outlook.com -all
Ads.txt Validation Test67% of top 100 sites passed
  • This website is using an Authorized Digital Sellers (ads.txt) file, but its content has invalid records! Having errors in this file would cause advertisers to not recognize and ignore the authorized sellers list and that will lead to lost revenue.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved