seo site checkup logo
PricingFree ToolsArticles
Report generated 3 months ago
https://www.allekullafinsnickeri.se
Your general SEO Checkup Score
Archived
77/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 77 out of 100, which is higher than the average score of 75. Our analysis has identified 14 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
14 Failed
3 Warnings
57 Passed
Issues to fix
HIGH
To provide a good user experience, Google recommends that sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.
HIGH
Connect your webpage with social media networks using APIs or AddThis, as social signals are becoming increasingly important for search engines to validate a site's trustworthiness and authority.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a First Contentful Paint value of 1.8 seconds or less.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
This website either lacks a favicon or it has not been referenced properly.
Common SEO issues
Score: 70
Failed: 6
Warnings: 2
Passed: 18
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Allekulla Finsnickeri
Length: 21 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 300 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Välkommen till Allekulla finsnickeri i Onsala, nära Kungsbacka – specialister på möbelsnickeri och handgjort inredning. Med passion för traditionellt hantverk skapar vi möbler, kök och unika designlösningar. Våra möbelsnickare kombinerar funktion, estetik och hållbarhet för tidlösa resultat som speg
Length: 300 characters
Google Search Results Preview Test
Desktop version
https://www.allekullafinsnickeri.se/Allekulla FinsnickeriVälkommen till Allekulla finsnickeri i Onsala, nära Kungsbacka – specialister på möbelsnickeri och handgjort inredning. Med passion för traditionellt hantverk skapar vi möbler, kök och unika designlösningar. Våra möbelsnickare kombinerar funktion, estetik och hållbarhet för tidlösa resultat som speg
Mobile version
https://www.allekullafinsnickeri.se/Allekulla FinsnickeriVälkommen till Allekulla finsnickeri i Onsala, nära Kungsbacka – specialister på möbelsnickeri och handgjort inredning. Med passion för traditionellt hantverk skapar vi möbler, kök och unika designlösningar. Våra möbelsnickare kombinerar funktion, estetik och hållbarhet för tidlösa resultat som speg
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:site_name
Allekulla Finsnickeri
og:title
Allekulla Finsnickeri
og:url
https://www.allekullafinsnickeri.se
og:type
website
og:description
Välkommen till Allekulla finsnickeri i Onsala, nära Kungsbacka – specialister på möbelsnickeri och handgjort inredning. Med passion för traditionellt hantverk skapar vi möbler, kök och unika designlösningar. Våra möbelsnickare kombinerar funktion, estetik och hållbarhet för tidlösa resultat som speg
og:image
http://static1.squarespace.com/static/671d3a82eb405e5d48f69d82/t/678e82d54d3d3634fe6938cf/1737392853919/AlleKulla_Logo_RGB_02_platta+2.PNG?format=1500w
og:image:width
1500
og:image:height
954
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
4menu4allekulla3portfolio3kontakt3hantverk
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
menu
allekulla
portfolio
kontakt
hantverk
Keywords Cloud Test
allekullaanvänderarkitektbehöverbidrarbyggerbyggtsbörjarclosecontentdesigndesignardetaljdinadrömhusegenellerfastaformgerformgivningframfrågorfrångedignagenerationergenomgenomtänktgenuinthantverkhantverkstjänsterharmoniskhelhethjälperhusdrömhusdrömmarhyllninghållahållerhögstahöraidéerinnaninredningarinstagraminstallerarjosefkonsultationkontaktkostarkunderkungsbackakunnandekvalitetkyrkorumkäntlokallösningarmaskinermaterialmenumodernmodernamonterarmöbelsnickerimöblermöjligtmötsnyttoffentligomgivningarnaonsalaopenplatsportfolioproduktionenprogrammetprojektprototypprototypbyggesamklangskaparskipsnickerisvävandesökertestatidlösatilltillsammanstraditionelltutanförutifrånvarjeverklighetenvillavälkommenvåravårtäktaöver
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Äkta hantverk. För en modern tid.
H2 tags
Våra hantverkstjänster
Villa Allekulla - Ett svävande drömhus
Vi finns på instagram
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test29% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Inline CSS Test10% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • This website either doesn't have a favicon or this has not been referenced correctly!
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html;charset=utf-8
Social Media Test75% of top 100 sites passed
  • This webpage is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 71
Failed: 6
Warnings: 0
Passed: 19
HTML Page Size Test23% of top 100 sites passed
  • The size of this webpage's HTML is 23.25 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 424 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 166.02 Kb to 23.25 Kb (86% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 10.91 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
72.3 %
3.17 Mb
javascript
19.8 %
891.45 Kb
css
3.5 %
158.86 Kb
font
3.5 %
157.88 Kb
html
0.5 %
22.07 Kb
other
0.3 %
14.70 Kb
TOTAL
100%
4.39 Mb
Requests by content type
Content type
Percent
Requests
javascript
36.6 %
15
image
22.0 %
9
font
14.6 %
6
css
12.2 %
5
other
12.2 %
5
html
2.4 %
1
TOTAL
100%
41
Content size by domain
Domain
Percent
Size
images.squarespace-cdn.com
72.3 %
3.17 Mb
assets.squarespace.com
18.7 %
841.28 Kb
static1.squarespace.com
4.5 %
202.74 Kb
use.typekit.net
2.5 %
110.55 Kb
fonts.gstatic.com
1.2 %
54.08 Kb
allekullafinsnickeri.se
0.8 %
36.13 Kb
fonts.googleapis.com
0.0 %
1.51 Kb
p.typekit.net
0.0 %
206 B
TOTAL
100%
4.39 Mb
Requests by domain
Domain
Percent
Requests
assets.squarespace.com
39.0 %
16
images.squarespace-cdn.com
17.1 %
7
allekullafinsnickeri.se
12.2 %
5
use.typekit.net
12.2 %
5
static1.squarespace.com
9.8 %
4
fonts.gstatic.com
4.9 %
2
fonts.googleapis.com
2.4 %
1
p.typekit.net
2.4 %
1
TOTAL
100%
41
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test100% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.017 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.017 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 10.921 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

10.921 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 10.92 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

10.92 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: För dig som söker genuint hantverk av högsta kvalitet. I vårt snickeri i Onsala ...
Html: <h4 style="text-align: center; white-space: pre-wrap; transit..." class="preFade fadeIn">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0067. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0067

0.1

0.25

DOM element which contributes the most to CLS score:
Html: <div class="section-background">
Score: 0.0067
Server and security
Score: 90
Failed: 2
Warnings: 0
Passed: 8
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.allekullafinsnickeri.se" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
www.allekullafinsnickeri.se
Subject Alternative Names (SANs)
www.allekullafinsnickeri.se
Not valid before
Sun, January 12o 2025, 11:21:47 pm (z)
Not valid after
Sat, April 12o 2025, 11:21:46 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R11
Intermediate certificate
Common name
R11
Organization
Let's Encrypt
Location
US
Not valid before
Wed, March 13o 2024, 12:00:00 am (z)
Not valid after
Fri, March 12o 2027, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=15552000
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test95% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test97% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 98
Failed: 0
Warnings: 1
Passed: 9
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.allekullafinsnickeri.se/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.allekullafinsnickeri.se" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:spf.loopia.se -all
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved