seo site checkup logo
PricingFree ToolsArticles
Report generated 2 years ago
http://www.alibi-bar.cz
Your general SEO Checkup Score
Archived
69/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 69 out of 100, which is below the average score of 75. However, there are 19 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
19 Failed
5 Warnings
45 Passed
Issues to fix
HIGH
Minify all CSS files to ensure faster loading times, improved performance and better caching.
HIGH
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.
HIGH
HTTP/2 protocol offers several key improvements, including faster page load times, improved performance, better security and more efficient use of network resources.
MEDIUM
Add a sitemap file to help search engine crawlers index content more thoroughly and quickly.
MEDIUM
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Using social media meta tags can improve the appearance and content of shared links on social media platforms, potentially increasing click-through rates and engagement with the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
For security reasons, it is recommended to turn off the server signature.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 71
Failed: 7
Warnings: 0
Passed: 18
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: ALIBI - Cocktail & Music Bar - Prague
Length: 37 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: ALIBI – Cocktail & Music Bar – jedinečné párty, oslavy, rozlučky v unikátních prostorech, hudba českých i zahraničních DJs, drinky připravované těmi nejlepšími barmany
Length: 170 characters
Google Search Results Preview Test
Desktop version
http://www.alibi-bar.cz/en/ALIBI - Cocktail & Music Bar - PragueALIBI – Cocktail & Music Bar – jedinečné párty, oslavy, rozlučky v unikátních prostorech, hudba českých i zahraničních DJs, drinky připravované těmi nejlepšími barmany
Mobile version
http://www.alibi-bar.cz/en/ALIBI - Cocktail & Music Bar - PragueALIBI – Cocktail & Music Bar – jedinečné párty, oslavy, rozlučky v unikátních prostorech, hudba českých i zahraničních DJs, drinky připravované těmi nejlepšími barmany
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
11alibi9dave8music8carlos7bema
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
alibi
dave
music
carlos
bema
Keywords Cloud Test
accordingalibiamazeamazingandyatmosphereawesomebartendersbasebeautifulbemabestbookingcarloscateringcelebrationscentrecityclubcocktailconsentcontactscookiecookiescrowdczechdancedavedawndecorationdistrictdrinksensureestablishingeventsexclusivityexperiencefamousflocksforeignfotoreportfreegalleriesgalleryguestshavingincludingjoselightinglikelocatedmadeiramaturemegamenumoodmusicměstonavigationnicenightnightclubnightlifenovépartiespartyplacepluginpopularpragueprahaprojectionremixedrenownedriderroadsceneseekingservicessetssimplysophisticatedstaffstellarstrongtastetoggletrendytrulyunforgettableunmatchedupcomingusesvibrantvisitwebsitewelcomewifiworldžitná
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
RECENT GALLERIES
H2 tags
Upcoming events
WELCOME TO ALIBI. COCKTAIL & MUSIC BAR WEBSITE
BEST DJ's
CELEBRATIONS AND PARTIES
CATERING
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • This website lacks a sitemap file! Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
SEO Friendly URL Test40% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test33% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test80% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook Google Plus Twitter 
Speed optimizations
Score: 69
Failed: 5
Warnings: 4
Passed: 14
HTML Page Size Test34% of top 100 sites passed
  • The size of this webpage's HTML is 11.59 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,365 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 57.3 Kb to 11.59 Kb (80% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 3.63 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
54.9 %
970.20 Kb
javascript
31.5 %
556.24 Kb
font
5.6 %
99.00 Kb
css
3.7 %
65.99 Kb
other
3.6 %
64.21 Kb
html
0.6 %
10.79 Kb
TOTAL
100%
1.73 Mb
Requests by content type
Content type
Percent
Requests
javascript
38.9 %
37
image
30.5 %
29
css
20.0 %
19
other
5.3 %
5
font
4.2 %
4
html
1.1 %
1
TOTAL
100%
95
Content size by domain
Domain
Percent
Size
alibi-bar.cz
70.1 %
1.21 Mb
maps.googleapis.com
11.5 %
202.51 Kb
connect.facebook.net
7.7 %
136.11 Kb
fonts.gstatic.com
5.6 %
99.00 Kb
tripadvisor.com
1.2 %
20.46 Kb
google-analytics.com
1.2 %
20.33 Kb
googleadservices.com
1.0 %
18.49 Kb
cdn.mouseflow.com
1.0 %
18.19 Kb
cdnjs.cloudflare.com
0.3 %
4.72 Kb
static.tacdn.com
0.2 %
3.41 Kb
Other
0.2 %
4.08 Kb
TOTAL
100%
1.73 Mb
Requests by domain
Domain
Percent
Requests
alibi-bar.cz
69.5 %
66
maps.googleapis.com
5.3 %
5
tripadvisor.com
4.2 %
4
fonts.gstatic.com
4.2 %
4
cdnjs.cloudflare.com
2.1 %
2
google-analytics.com
2.1 %
2
connect.facebook.net
2.1 %
2
google.com
2.1 %
2
static.tacdn.com
2.1 %
2
googleadservices.com
1.1 %
1
Other
5.3 %
5
TOTAL
100%
95
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test99% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • This webpage is using CSS resources that are not minified!
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is not using render-blocking resources.
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 2.85 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

2.85 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img src="http://www.alibi-bar.cz/wp-content/uploads/2015/08..." class="attachment-original size-original wp-post-image" alt="" srcset="http://www.alibi-bar.cz/wp-content/uploads/2015/08..." sizes="(max-width: 1200px) 100vw, 1200px">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.229. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.2288

0.1

0.25

DOM element which contributes the most to CLS score:
Html: <div id="services">
Score: 0.2221
Server and security
Score: 63
Failed: 5
Warnings: 0
Passed: 4
URL Canonicalization Test92% of top 100 sites passed
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is not using the HTTP/2 protocol!
HSTS Test
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
Server: Apache/2.4.10 (Debian)
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 54
Failed: 2
Warnings: 1
Passed: 6
Structured Data Test59% of top 100 sites passed
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved