seo site checkup logo
PricingFree ToolsArticles
Report generated 3 years ago
https://www.aapalabaliraja.in/2022/09/soybean-rate-2022.html
Your general SEO Checkup Score
Archived
97/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 97 out of 100, which is higher than the average score of 75. Our analysis has identified 13 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
13 Failed
3 Warnings
53 Passed
Common SEO issues
Score: 79
Failed: 2
Warnings: 3
Passed: 17
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 97 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Soybean Rate 2022 : आजचे सोयाबीनचे बाजार भाव २८ सप्टेंबर २०२२ || aajache soybean bajar bhav today
Length: 97 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 113 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: आजचे सोयाबीनचे बाजार भाव || soybean rate, aajache soybean bajar bhav today, बाजार भाव दरोरज पाहण्यासाठी खाली पहा.
Length: 113 characters
Google Search Results Preview Test
Desktop version
https://www.aapalabaliraja.in/2022/09/soybean-rate-2022.htmlSoybean Rate 2022 : आजचे सोयाबीनचे बाजार भाव २८ सप्टेंबर २०२२ || aajache soybean bajar bhav todayआजचे सोयाबीनचे बाजार भाव || soybean rate, aajache soybean bajar bhav today, बाजार भाव दरोरज पाहण्यासाठी खाली पहा.
Mobile version
https://www.aapalabaliraja.in/2022/09/soybean-rate-2022.htmlSoybean Rate 2022 : आजचे सोयाबीनचे बाजार भाव २८ सप्टेंबर २०२२ || aajache soybean bajar bhav todayआजचे सोयाबीनचे बाजार भाव || soybean rate, aajache soybean bajar bhav today, बाजार भाव दरोरज पाहण्यासाठी खाली पहा.
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:url
https://www.aapalabaliraja.in/2022/09/soybean-rate-2022.html
og:title
Soybean Rate 2022 : आजचे सोयाबीनचे बाजार भाव २८ सप्टेंबर २०२२ || aajache soybean bajar bhav today
og:description
आजचे सोयाबीनचे बाजार भाव || soybean rate, aajache soybean bajar bhav today, बाजार भाव दरोरज पाहण्यासाठी खाली पहा.
og:image
https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEjfLwPz1k_jd4kSdjqVfKnMeOQAflU8v67MnoLOae_AFt_X9lXJftjTh7SoFn4y1nVCJ-eOu5SsESKah5LLQNEPqgPrzluW0YpEj5EI0nh_vEACHDlEuw0K6ZfUWZCxxe7KiokZIRpi0RU3cXEE9DgFguzCzMF-lXPiyNIIFZEDWtLoD6p2iliQMJsm5w/w1200-h630-p-k-no-nu/Soybean_Rate_2022.jpg
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
17bajar15samiti9soybean4home4rate
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
bajar
samiti
soybean
home
rate
Keywords Cloud Test
aajacheaapalaakolabajarbalirajabeedbhavbhokarcategoriesconditionscontactcopyrightdailydatedeulgaondisclaimersexamfacebookfootergangakhedgoldgrouphomejinturlaturmalakapurmalegaonmarketmenunewsparturpolicypopularpostspriceprivacyratesamitisearchsilversitemapsoybeanstoriestasgavtermstodaytwitterumarkhedvardhavarietywhatsappwidgetyavatmalइटवरउमरखयवतम
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Soybean Rate 2022 : आजचे सोयाबीनचे बाजार भाव २८ सप्टेंबर २०२२ || aajache soybean bajar bhav today
H2 tags
आजचे सोयाबीनचे बाजार भाव || soybean rate २०२२
KDS 726 soybean variety : फुले संगम 726 विविधता
Gold silver price : आज Market मध्ये सोने चांदीचे किंमती ढासळल्या
SSC HSC Exam Date 2022-2023 : दहावी आणि बारावीच्या परीक्षा होणार या संभाव्य तारखेला
Soybean Rate : आजचे सोयाबीनचे बाजार भाव २४ सप्टेंबर २०२२
Soybean : आजचे सोयाबीनचे भाव लगेच‍ पहा
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
Image Alt Test71% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test38% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test72% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test33% of top 100 sites passed
  • This webpage has some warnings caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 79
Failed: 5
Warnings: 0
Passed: 13
HTML Page Size Test34% of top 100 sites passed
  • The size of this webpage's HTML is 30.65 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,055 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 162.38 Kb to 30.65 Kb (81% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 3.31 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
70.4 %
1.01 Mb
font
11.2 %
165.71 Kb
html
10.1 %
148.52 Kb
image
4.8 %
70.78 Kb
css
2.7 %
39.95 Kb
other
0.8 %
11.85 Kb
TOTAL
100%
1.44 Mb
Requests by content type
Content type
Percent
Requests
javascript
35.5 %
27
html
26.3 %
20
image
11.8 %
9
css
9.2 %
7
other
9.2 %
7
font
7.9 %
6
TOTAL
100%
76
Content size by domain
Domain
Percent
Size
blogger.com
26.8 %
396.01 Kb
pagead2.googlesyndication.com
18.6 %
274.01 Kb
gstatic.com
12.3 %
181.74 Kb
googletagmanager.com
7.6 %
111.67 Kb
aapalabaliraja.in
6.2 %
91.02 Kb
fonts.gstatic.com
6.1 %
89.79 Kb
stackpath.bootstrapcdn.com
5.6 %
83.28 Kb
cdn.onesignal.com
4.8 %
70.85 Kb
blogger.googleusercontent.com
4.4 %
65.14 Kb
ajax.googleapis.com
2.3 %
33.87 Kb
Other
5.3 %
77.59 Kb
TOTAL
100%
1.44 Mb
Requests by domain
Domain
Percent
Requests
blogger.com
15.8 %
12
googleads.g.doubleclick.net
14.5 %
11
pagead2.googlesyndication.com
9.2 %
7
blogger.googleusercontent.com
9.2 %
7
fonts.gstatic.com
6.6 %
5
google-analytics.com
5.3 %
4
google.com
5.3 %
4
adservice.google.com
3.9 %
3
gstatic.com
3.9 %
3
tpc.googlesyndication.com
3.9 %
3
Other
22.4 %
17
TOTAL
100%
76
CDN Usage Test96% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test99% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test96% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 0.7 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

0.7 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Soybean bhav : नमस्कार शेतकरी मित्रांनो, आज २८ सप्टेंबर २०२२ सोयाबीन बाजार भाव ज...
Html: <p style="text-align: justify;">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.0. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0

0.1

0.25

DOM element which contributes the most to CLS score:
Html:
Score: 0
Server and security
Score: 67
Failed: 2
Warnings: 0
Passed: 4
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.aapalabaliraja.in" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
www.aapalabaliraja.in
Subject Alternative Names (SANs)
www.aapalabaliraja.in
Not valid before
Sat, August 27o 2022, 1:24:23 am (z)
Not valid after
Fri, November 25o 2022, 1:24:22 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GTS CA 1D4
Intermediate certificate
Common name
GTS CA 1D4
Organization
Google Trust Services LLC
Location
US
Not valid before
Thu, August 13o 2020, 12:00:42 am (z)
Not valid after
Thu, September 30o 2027, 12:00:42 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GTS Root R1
Root certificate
Common name
GTS Root R1
Organization
Google Trust Services LLC
Location
US
Not valid before
Wed, June 22o 2016, 12:00:00 am (z)
Not valid after
Sun, June 22o 2036, 12:00:00 am (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
GTS Root R1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
Plaintext Emails Test93% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1, minimum-scale=1, maximum-scale=1" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 92
Failed: 2
Warnings: 0
Passed: 7
Structured Data Test59% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.aapalabaliraja.in/2022/09/soybean-rate-2022.html is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.aapalabaliraja.in/2022/09/soybean-rate-2022.html" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • The robots.txt file disallow the search engines access to some parts of your website! You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test80% of top 100 sites passed
  • This website is using an Authorized Digital Sellers (ads.txt) file and its content has a valid format. Since the file is uploaded and maintained by publishers on their own domain, it's not easy for bad players to gain access to it or to change entries. Buyers who want to bid on the publisher's inventory can refer to their ads.txt file and confidently know that the exchange they are dealing with is in fact authorized to directly or indirectly sell the publisher's inventory.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved