seo site checkup logo
PricingFree ToolsArticles
Report generated 2 years ago
https://written-update.com/written-update/anupama-17th-july-2023-written-update
Your general SEO Checkup Score
Archived
83/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 83 out of 100, which is higher than the average score of 75. Our analysis has identified 8 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
8 Failed
2 Warnings
59 Passed
Issues to fix
HIGH
To address URL canonicalization issues, it is recommended to select a primary URL for your webpage and set up redirects from all other variations to the preferred one.
HIGH
Connect your webpage with social media networks using APIs or AddThis, as social signals are becoming increasingly important for search engines to validate a site's trustworthiness and authority.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
MEDIUM
Add a sitemap file to help search engine crawlers index content more thoroughly and quickly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
MEDIUM
Using social media meta tags can improve the appearance and content of shared links on social media platforms, potentially increasing click-through rates and engagement with the page.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
Common SEO issues
Score: 73
Failed: 5
Warnings: 1
Passed: 19
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Anupama 17th July 2023 Written Update
Length: 37 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 245 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Anupama 17th July 2023 Written Update: Anupama written update Today's Anupama 17th July 2023 episode starts with Anupama telling herself that she has won despite leaving her dreams. Everyone greets Anupama warmly while Choti Anu excitedly claims
Length: 245 characters
Google Search Results Preview Test
Desktop version
https://written-update.com/written-update/anupama-17th-july-2023-written-updateAnupama 17th July 2023 Written UpdateAnupama 17th July 2023 Written Update: Anupama written update Today's Anupama 17th July 2023 episode starts with Anupama telling herself that she has won despite leaving her dreams. Everyone greets Anupama warmly while Choti Anu excitedly claims
Mobile version
https://written-update.com/written-update/anupama-17th-july-2023-written-updateAnupama 17th July 2023 Written UpdateAnupama 17th July 2023 Written Update: Anupama written update Today's Anupama 17th July 2023 episode starts with Anupama telling herself that she has won despite leaving her dreams. Everyone greets Anupama warmly while Choti Anu excitedly claims
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
21anupama18written17update17july5episode
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
anupama
written
update
july
episode
Keywords Cloud Test
afterwardamericaangrilyangryanujanupamaanymoreawaybarkhabhagyacallschoticlaimscomecomingcompletedancedancingdarknessdecidesdespitedevidiyadoesdreamdreamsepisodeexcitedlyeyesfamilyfeelgetsgoesgossipsgreetgreetshandhappenhomeimliejulyknewleavingleelalightsmakesmaltimayameetsmembersmothernakulneednewsorderingorderspandyaperformingphotoplusproudpyaarreasonreturnrollsayingsendsserialshahshaktishivspoilersspreadstarstartsstopsstorestorystudiosuddentalktandavtellingtellstellybesttimetitlitodaytonighttriestwistupcomingupdatewarmlywingswitnessesworrywrittenyashodayrkkh
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Anupama 17th July 2023 Written Update
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • This website lacks a sitemap file! Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
SEO Friendly URL Test40% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test2% of top 100 sites passed
  • This webpage is not using inline CSS styles.
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test80% of top 100 sites passed
  • This webpage is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 90
Failed: 1
Warnings: 1
Passed: 19
HTML Page Size Test34% of top 100 sites passed
  • The size of this webpage's HTML is 3.72 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 507 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 18.82 Kb to 3.72 Kb (80% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 1.02 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage has less than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from the server, which will ultimately slow down the loading of your webpage.
Content size by content type
Content type
Percent
Size
image
92.7 %
90.18 Kb
html
5.2 %
5.01 Kb
css
2.1 %
2.05 Kb
javascript
0.0 %
0 B
font
0.0 %
0 B
other
0.0 %
0 B
TOTAL
100%
97.24 Kb
Requests by content type
Content type
Percent
Requests
image
71.4 %
5
html
14.3 %
1
css
14.3 %
1
javascript
0.0 %
0
font
0.0 %
0
other
0.0 %
0
TOTAL
100%
7
Content size by domain
Domain
Percent
Size
img.tellybest.com
89.5 %
87.02 Kb
written-update.com
7.3 %
7.06 Kb
media.tellybest.com
3.2 %
3.15 Kb
TOTAL
100%
97.24 Kb
Requests by domain
Domain
Percent
Requests
img.tellybest.com
57.1 %
4
written-update.com
28.6 %
2
media.tellybest.com
14.3 %
1
TOTAL
100%
7
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test
  • This webpage is not using images with large metadata.
Image Caching Test99% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • This webpage is not using JavaScript resources from the same domain.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 83
Failed: 1
Warnings: 0
Passed: 9
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "written-update.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
www.written-update.com
Subject Alternative Names (SANs)
written-update.com, www.written-update.com
Not valid before
Fri, August 18o 2023, 3:50:34 am (z)
Not valid after
Thu, November 16o 2023, 3:50:33 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R3
Intermediate certificate
Common name
R3
Organization
Let's Encrypt
Location
US
Not valid before
Fri, September 4o 2020, 12:00:00 am (z)
Not valid after
Mon, September 15o 2025, 4:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 92
Failed: 1
Warnings: 0
Passed: 9
Structured Data Test59% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
<link href="https://written-update.com/written-update/anupama-17th-july-2023-written-update" itemprop="mainEntityOfPage" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test80% of top 100 sites passed
  • This website is using an Authorized Digital Sellers (ads.txt) file and its content has a valid format. Since the file is uploaded and maintained by publishers on their own domain, it's not easy for bad players to gain access to it or to change entries. Buyers who want to bid on the publisher's inventory can refer to their ads.txt file and confidently know that the exchange they are dealing with is in fact authorized to directly or indirectly sell the publisher's inventory.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved