seo site checkup logo
PricingFree ToolsArticles
Report generated 4 years ago
https://willingways.org
Your general SEO Checkup Score
Archived
69/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 69 out of 100, which is below the average score of 75. However, there are 15 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
15 Failed
1 Warnings
42 Passed
Common SEO issues
Score: 68
Failed: 5
Warnings: 1
Passed: 17
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: Willing Ways | Best Addiction Rehabilitation Treatment Center in Pakistan | 24/7
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: Willing Ways | is the Best addiction Rehabilitation treatment center in Pakistan. We are the pioneer in drugs & alcohol treatment centers with outstanding services and a history of 43 years.
Google Search Results Preview Test
Desktop version
https://willingways.orgWilling Ways | Best Addiction Rehabilitation Treatment Center in Pakistan | 24/7Willing Ways | is the Best addiction Rehabilitation treatment center in Pakistan. We are the pioneer in drugs & alcohol treatment centers with outstanding services and a history of 43 years.
Mobile version
https://willingways.orgWilling Ways | Best Addiction Rehabilitation Treatment Center in Pakistan | 24/7Willing Ways | is the Best addiction Rehabilitation treatment center in Pakistan. We are the pioneer in drugs & alcohol treatment centers with outstanding services and a history of 43 years.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
33counseling28news23services15lahore15sadaqat
Keywords Usage Test
  • Your most common keywords are not appearing in one or more of the meta-tags above. Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines.
Keyword(s) not included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
addictionalcoholismappearancesarticlesaskedbestbranchescarecenterschemicalchiefcliniccollegecommunicationcontactcorecostcounselingcrisisdegreedenialdevelopmentdirectoremergenciesemotionalexecutiveexecutivesexpressfamilyfaqsfollowgovernmentgriefhealthhelphistoryhomeimageinterventionislamabadkarachilahorelifemanagementmedicalmentalmissionmohsinmuradmurreenawaznewsofficerpakistanpersonalpersonalityproblemsprogramprogramspsychiatricpsychiatristspsychologypublicationsreadrecoveryregulationrehabrunawaysadaqatseminarsservicessessionsshowssituationalspecialistsstepsstrategiessupportivetalaltalkteamtexttheektitletoughtreatmenttreatmentsuniversityupdatesvaluesvideosvisionvisitwakeelwayswillingwillingwaysworkaholismworldzubair
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your page contains too many H2 tags. H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
The Best Addiction & Psychiatric Treatment Centers in Pakistan
H2 tags
About Us
our Branches
LAHORE
KARACHI
ISLAMABAD
What we offer
Our Core Treatments
Personal Development Counseling
Follow-up Counseling
Our Executive Team
Dr. Sadaqat Ali on TV Shows
Willing Ways Programs
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
SEO Friendly URL Test
  • Your webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test
  • All of your webpage's "img" tags have the required "alt" attribute.
Responsive Image Test
  • Not all images in this page are properly sized! You are serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Console Errors Test
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Social Media Test
  • Congratulations! Your website is connected successfully with social media using:
FacebookĀ TwitterĀ 
Speed optimizations
Score: 74
Failed: 3
Warnings: 0
Passed: 13
HTML Page Size Test
HTML Compression/GZIP Test
  • Your webpage doesn't use any HTML compression! You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 82% - from 252.93 Kb to 44.45 Kb .
Site Loading Speed Test
  • Your website loading time is around 1.04 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
  • Congratulations, your page has fewer than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from your server, which will ultimately slow down the loading of your web page.
Content size by content type
Content type
Percent
Size
html
60.2 %
253.67 Kb
css
19.8 %
83.26 Kb
font
12.7 %
53.42 Kb
image
6.0 %
25.48 Kb
javascript
1.3 %
5.61 Kb
other
0.0 %
0 B
TOTAL
100%
421.44 Kb
Requests by content type
Content type
Percent
Requests
font
30.0 %
3
css
20.0 %
2
javascript
20.0 %
2
image
20.0 %
2
html
10.0 %
1
other
0.0 %
0
TOTAL
100%
10
Content size by domain
Domain
Percent
Size
willingways.org
60.2 %
253.67 Kb
willingways.b-cdn.net
24.2 %
102.05 Kb
fonts.gstatic.com
10.9 %
46.14 Kb
willingways.cc
4.4 %
18.56 Kb
fonts.googleapis.com
0.2 %
1.02 Kb
TOTAL
100%
421.44 Kb
Requests by domain
Domain
Percent
Requests
willingways.b-cdn.net
50.0 %
5
fonts.gstatic.com
20.0 %
2
willingways.org
10.0 %
1
fonts.googleapis.com
10.0 %
1
willingways.cc
10.0 %
1
TOTAL
100%
10
Page Cache Test (Server Side Caching)
  • It does not appear that you are caching your pages. Cached pages serve up static html and avoid potentially time consuming queries to your database. It also helps lower server load by up to 80%. Caching most visibly benefits high traffic pages that access a database, but whose content does not change on every page view. Common caching methods include Alternative PHP Cache, Quickcache, and WP Super Cache (for Wordpress sites). Caching mechanisms also typically compress HTML, further reducing page size and load time.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test
  • Your webpage is serving all images, javascript and css resources from CDNs.
See results list
Image Caching Test
  • Your webpage is not using uncached images from your domain.
JavaScript Caching Test
  • Your webpage is not using uncached JavaScript resources from your domain.
CSS Caching Test
  • Your webpage is not using uncached CSS resources from your domain.
JavaScript Minification Test
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test
  • Congratulations! Your webpage's CSS resources are minified.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 69
Failed: 3
Warnings: 0
Passed: 5
URL Canonicalization Test
HTTPS Test
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.
Mixed Content Test (HTTP over HTTPS)
  • Congratulations, this webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test
  • This webpage is not using the HTTP/2 protocol!
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
Server: nginx/1.21.1
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We've found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1, maximum-scale=1" />
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 43
Failed: 4
Warnings: 0
Passed: 4
Structured Data Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Custom 404 Error Page Test
  • Your website is not using a custom 404 error page. Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave your site entirely, and looks unprofessional. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://willingways.org is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://willingways.org/" rel="canonical"/>
Nofollow Tag Test
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
See results list
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
Meta Refresh Test
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved