seo site checkup logo
PricingFree ToolsArticles
Report generated 8 days ago
https://webxtalk.com
Your general SEO Checkup Score
Archived
65/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 65 out of 100, which is below the average score of 75. However, there are 18 SEO issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
18 Failed
7 Warnings
36 Passed
Issues to fix
HIGH
To provide a good user experience, Google recommends that sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a Time To First Byte value of 0.8 seconds or less.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a First Contentful Paint value of 1.8 seconds or less.
MEDIUM
Consider adding cache headers for JavaScript resources to speed up the webpage for returning users.
MEDIUM
Consider adding cache headers for CSS resources to speed up the webpage for returning users.
MEDIUM
HTTP/2 protocol offers several key improvements, including faster page load times, improved performance, better security and more efficient use of network resources.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Consider reducing the HTML size to improve loading times and retain visitors.
LOW
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 82
Failed: 2
Warnings: 2
Passed: 18
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Top Digital Marketing Agency | ROI-Focused | Webxtalk
Length: 53 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: With 10+ years of expertise, Webxtalk is a top digital marketing agency, boosting client revenues by 250%. See why we're the #1 digital marketing firm.
Length: 151 characters
Google Search Results Preview Test
Desktop version
https://webxtalk.com/Top Digital Marketing Agency | ROI-Focused | WebxtalkWith 10+ years of expertise, Webxtalk is a top digital marketing agency, boosting client revenues by 250%. See why we're the #1 digital marketing firm.
Mobile version
https://webxtalk.com/Top Digital Marketing Agency | ROI-Focused | WebxtalkWith 10+ years of expertise, Webxtalk is a top digital marketing agency, boosting client revenues by 250%. See why we're the #1 digital marketing firm.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:title
Digital Marketing Agency in USA | ROI-Focused | Webxtalk Pvt. Ltd.
og:site_name
webxtalk
og:url
https://webxtalk.com/
og:description
Elevate your online presence with our results-driven digital marketing agency services in USA. Contact us today for a free consultation!
og:type
Article
og:image
https://webxtalk.com/wp-content/uploads/2024/08/Untitled-design-3.jpg
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
41website36marketing25webxtalk22services20design
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
website
marketing
webxtalk
services
design
Keywords Cloud Test
achieveagencyanalysisapproachaudiencebasedbestbetterbuildbusinesscampaigncampaignschinaclearclickclientclientscommunicationcompanycontactcontentcontinuouscreatecurrentdesigndesigningdetaileddevelopmentdigitaleffortsemailensuresexpertfreegettinggoalgoalsgooglegreatgrowhavehelphighlyhtmlidentifyimprovementincreasingindustryleadslikemanagementmarketingmediamysqlnavigationneedsofficeonlineoptimizationoptimizingpackagepageperformancepressprocessprofessionalprojectproposalprovidedproviderqualityreachreportingreputationresultresultsreviewsalesserviceservicessettingsocialstrategicstrategiesstrategysuccesstargettargetingteamtechthankstimetrustusedwebsitewebxtalkwoocommercewordworkworking
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Digital marketing agency that drives real sales
H2 tags
Check Your Needs Here
Grow with Webxtalk Easy Work Process
Our Company Advantages
Our Design & Digital Marketing Services
Technologies we are experts in
Some Of Our Works
Awesome Reviews
Join our growing client list
Frequently asked questions
Location-based services
Get Free Proposal
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage has some warnings caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 36
Failed: 11
Warnings: 4
Passed: 5
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,550 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 375.86 Kb to 59.71 Kb (84% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 22.92 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 2 seconds!
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
55.5 %
1.53 Mb
font
15.6 %
440.13 Kb
image
13.2 %
372.42 Kb
css
11.6 %
326.88 Kb
html
3.6 %
100.33 Kb
other
0.5 %
15.03 Kb
TOTAL
100%
2.75 Mb
Requests by content type
Content type
Percent
Requests
javascript
34.0 %
52
image
34.0 %
52
css
20.9 %
32
font
6.5 %
10
other
2.6 %
4
html
2.0 %
3
TOTAL
100%
153
Content size by domain
Domain
Percent
Size
webxtalk.com
36.1 %
1018.61 Kb
gstatic.com
30.4 %
856.70 Kb
code.jivosite.com
13.6 %
381.87 Kb
i0.wp.com
8.4 %
237.16 Kb
googletagmanager.com
5.1 %
143.34 Kb
c0.wp.com
2.6 %
73.76 Kb
fonts.gstatic.com
2.0 %
56.43 Kb
google.com
1.7 %
46.55 Kb
stats.wp.com
0.1 %
1.72 Kb
fonts.googleapis.com
0.0 %
1.21 Kb
Other
0.0 %
587 B
TOTAL
100%
2.75 Mb
Requests by domain
Domain
Percent
Requests
webxtalk.com
58.8 %
90
i0.wp.com
19.0 %
29
code.jivosite.com
7.2 %
11
c0.wp.com
5.2 %
8
fonts.gstatic.com
3.3 %
5
gstatic.com
2.0 %
3
google.com
1.3 %
2
fonts.googleapis.com
0.7 %
1
googletagmanager.com
0.7 %
1
stats.wp.com
0.7 %
1
Other
1.3 %
2
TOTAL
100%
153
CDN Usage Test95% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test95% of top 100 sites passed
See results list
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is not using cache headers for JavaScript resources! Setting cache headers can help to speed up the webpage for returning users.
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using cache headers for CSS resources! Setting cache headers can help to speed up the webpage for returning users.
See results list
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 18.532 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

18.532 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 20.656 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

20.656 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 21.4 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

21.4 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Digital Marketing Agency That Drives Real Sales Your Growth is Our Only Mission...
Html: <section data-bg-image="url" class="vc_row wpb_row vc_row-fluid banner-sec herosec-tes...">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.1261. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.1261

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Website Designing SEO(Search Engine Optimization) Social Media Marketing Google ...
Html: <div class="carousel-items row flickity-enabled is-draggable" data-lqd-flickity="{"cellAlign":"center","prevNextButtons":true,"butt..." tabindex="0">
Score: 0.1165
Server and security
Score: 74
Failed: 4
Warnings: 0
Passed: 3
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "webxtalk.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
webxtalk.com
Subject Alternative Names (SANs)
*.webxtalk.com, webxtalk.com
Not valid before
Wed, October 1o 2025, 1:30:56 pm (z)
Not valid after
Tue, December 30o 2025, 1:30:55 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R13
Intermediate certificate
Common name
R13
Organization
Let's Encrypt
Location
US
Not valid before
Wed, March 13o 2024, 12:00:00 am (z)
Not valid after
Fri, March 12o 2027, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is not using the HTTP/2 protocol!
HSTS Test84% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Plaintext Emails Test97% of top 100 sites passed
  • We've found 4 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 98
Failed: 1
Warnings: 1
Passed: 7
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://webxtalk.com/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://webxtalk.com/" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • The robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 +a +mx +ip4:162.240.38.215 +ip4:162.240.209.127 ~all
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved