seo site checkup logo
PricingFree ToolsArticles
Report generated 9 years ago
http://vtsupply.com/guntec-usa-m-lok-free-floating-monolithic-lightweight-handguard.html
Your general SEO Checkup Score
Archived
60/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 60 out of 100, which is below the average score of 75. However, there are 12 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
12 Failed
0 Warnings
28 Passed
Common SEO issues
Score: 61
Failed: 4
Warnings: 0
Passed: 11
Google Search Results Preview
Desktop version
http://vtsupply.com/guntec-usa-m-lok-free-floating-monolithic-lightweight-handguard.htmlGuntec USA Made M-LOK Free Floating Monolithic Lightweight Handguard 4" 7" 9" 10Guntec provides a high quality US Made lightweight handguard with a monolithic top rail at the lowest price in the modular Magpul M-LOK rail platform.Guntec USA M-LOK Free Floating Monolithic Lightweight Handguard (GT-MLK) by Guntec USA - Guntec USA Made M-LOK Free Floating Monolithic Lightweight Handguard 4quot; 7quot; 9quot; 10quot; 12quot; 15quot; (Select Size) GT-4MLK,...
Mobile version
http://vtsupply.com/guntec-usa-m-lok-free-floating-monolithic-lightweight-handguard.htmlGuntec USA Made M-LOK Free Floating Monolithic Lightweight Handguard 4" 7" 9" 10Guntec provides a high quality US Made lightweight handguard with a monolithic top rail at the lowest price in the modular Magpul M-LOK rail platform.Guntec USA M-LOK Free Floating Monolithic Lightweight Handguard (GT-MLK) by Guntec USA - Guntec USA Made M-LOK Free Floating Monolithic Lightweight Handguard 4quot; 7quot; 9quot; 10quot; 12quot; 15quot; (Select Size) GT-4MLK,...
Keywords Cloud
accessoriesaddedaluminumambiambidextrousannodizedaprilarmsarticlesavailablebarrelbasicblackboughtcarbinecatalogcategoriescmmgcolorcommonconditionscustomersdarkdealdefensedrabdutyearthextendedfinishfloatingforearmfreegg&ggiftgreengripsguntechandguardheartbleedheavyholographicincludingindustriesinformationintrafuselengthlightweightmagazinemagpulmanufacturersmlokmodularmonolithicoliveonlineoptionaloptionsoxidepalmpartspicatinnypistolpistol/carbine/mid/rifleproductproductspurchasedquantityquestionsquickrailrailsreceiverrestreturnsreviewreviewsriflesafesafetyshippingshipssightssizesnipersortedspectersteelsundaysystemstacticaltalontapcotermstotaltroyvoucherweaponsweightwrite
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
SEO Friendly URL Test
  • This analyzed URL is SEO friendly, but internal links on this page contain some links that are not SEO friendly.
See results list
Image Alt Test
  • Your webpage has 128 'img' tags and 91 of them are missing the required 'alt' attribute.
See full list
Inline CSS Test
  • Your webpage is using 8 inline CSS styles!
See results list
Deprecated HTML Tags
  • We found some HTML deprecated tags. You are advised to change these old tags with equivalent tags or proper CSS rules.
Google Analytics Test
  • Congratulations! Your website is using the correct version of Google Analytics tracking code.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your web page.
Social Media Check
  • Congratulations! Your website is connected successfully with social media using: Facebook; Twitter;
Speed optimizations
Score: 46
Failed: 5
Warnings: 0
Passed: 5
HTML Page Size Test
HTML Compression/GZIP Test
  • Your page do not use any HTML compression!
    You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 84 % - from 60.13 Kb to 9.59 Kb which would further reduce your page loading time.
Site Loading Speed Test
  • Your site loading time is around 2.384 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 69
  • 3 HTML Pages
  • 5 CSS Files
  • 9 JS Files
  • 51 Images
  • 1 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduce server load.
Flash Test
  • Warning: your website contains flash objects. Flash is an outdated technology that is used to deliver rich multimedia content. Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
See results list
Image Caching Test
  • Congratulations! Your webpage use 'Expires' header for your images and the browsers will display these images from the cache.
Nested Tables Test
  • It appears that your site contains nested tables. Nested tables can be slow to render in some browsers. Consider using a CSS layout to reduce both HTML size and page loading time.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE HTML PUBLIC &quot;-//W3C//DTD HTML 4.01 Transitional//EN&quot;>
Server and security
Score: 0
Failed: 1
Warnings: 0
Passed: 4
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 0
Failed: 1
Warnings: 0
Passed: 1
Media Query Responsive Test
  • Your website is not using media queries. You should consider using this technique in order to implement responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 80
Failed: 1
Warnings: 0
Passed: 6
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your page does not use the canonical link tag.
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engins will crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file is using the disallow directive but it's empty. This means that the whole website can be crawled by search engines.
SPF Records Checker
  • Congratulations! Your DNS server is using an SPF record. This SPF record is listed below:
v=spf1 a mx ptr ip4:162.144.46.247 mx:VTSUPPLY.COM include:bluehost.com ip4:162.144.38.205 -all
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved