seo site checkup logo
PricingFree ToolsArticles
Report generated 2 years ago
https://vhealth.io
Your general SEO Checkup Score
Archived
64/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 64 out of 100, which is below the average score of 75. However, there are 21 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
21 Failed
5 Warnings
45 Passed
Issues to fix
HIGH
To provide a good user experience, sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.
HIGH
To provide a good user experience, sites should aim for a Cumulative Layout Shift score of 0.1 or less.
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
HTTP/2 protocol offers several key improvements, including faster page load times, improved performance, better security and more efficient use of network resources.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Using social media meta tags can improve the appearance and content of shared links on social media platforms, potentially increasing click-through rates and engagement with the page.
LOW
Keep in mind that the NOINDEX meta tag instructs search engines not to index a webpage. Please verify if this is the intended behavior, as the webpage will not appear in search engine results.
LOW
Use only one canonical link tag per webpage, as multiple tags will cause search engines to ignore all of them, potentially leading to duplicate content issues.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
Replace deprecated HTML tags with their modern equivalents or appropriate CSS rules.
Common SEO issues
Score: 68
Failed: 6
Warnings: 3
Passed: 16
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Online Medical Consultation India | MediBuddy vHealth
Length: 53 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 305 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Best Healthcare Membership Plans in India. Get unlimited consultations from the top rated doctors (general physicians), psychologists and dieticians, Annual Health check-up, Dental check-up, free OPD and pharmacy benefits and MediBuddy vHealth Network Benefits. Best prices. Big Savings. Trusted Partners.
Length: 305 characters
Google Search Results Preview Test
Desktop version
https://www.vhealth.io/Online Medical Consultation India | MediBuddy vHealthBest Healthcare Membership Plans in India. Get unlimited consultations from the top rated doctors (general physicians), psychologists and dieticians, Annual Health check-up, Dental check-up, free OPD and pharmacy benefits and MediBuddy vHealth Network Benefits. Best prices. Big Savings. Trusted Partners.
Mobile version
https://www.vhealth.io/Online Medical Consultation India | MediBuddy vHealthBest Healthcare Membership Plans in India. Get unlimited consultations from the top rated doctors (general physicians), psychologists and dieticians, Annual Health check-up, Dental check-up, free OPD and pharmacy benefits and MediBuddy vHealth Network Benefits. Best prices. Big Savings. Trusted Partners.
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
76voucher71vhealth71health66members61family
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
voucher
vhealth
health
members
family
Keywords Cloud Test
accessannualbenefitbenefitsbengalibloodcarecheckcheckupcitiesclinicscompletecomprehensivecomprisesconsultationconsultationscostcustomerdedicateddeficiencydentaldiabeticdietdieticiansdoctordoctorsenglishensuringexclusiveexpensesexperienceexpertfamilyfeaturesfollowfunctiongeneralgoldguidancegujaratihealthhealthcarehemogramhindiholidayshospitalsincludingironkannadalanguageslipidlivermalayalammarathimedibuddymembermembersmembershipmentalmonthsnationalnetworkoraloriyapackagepartnerpersonalizedpharmacyphysicianphysiciansplansprioritizeprofilepsychologicalpsychologistsregionalrenalsavesavingsscreeningspecialistsundaystamiltelugutesttestimoniesteststhyroidunlimitedunlockvalidityvhealthviewvitalvitaminvouchervoucherswellnessworthyear
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
Find perfect health package for you and your family
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • This website has a sitemap file.
SEO Friendly URL Test40% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • We found some HTML deprecated tags! You are advised to change these old tags with equivalent tags or proper CSS rules.
1menu
Google Analytics Test69% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test33% of top 100 sites passed
  • This webpage has some warnings caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Social Media Test80% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 51
Failed: 9
Warnings: 2
Passed: 12
HTML Page Size Test34% of top 100 sites passed
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 5,704 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 572.86 Kb to 54.34 Kb (91% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 11.99 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
55.7 %
2.84 Mb
javascript
38.8 %
1.98 Mb
font
2.4 %
125.93 Kb
css
2.1 %
109.96 Kb
other
0.8 %
43.59 Kb
html
0.2 %
12.18 Kb
TOTAL
100%
5.11 Mb
Requests by content type
Content type
Percent
Requests
image
48.7 %
37
javascript
21.1 %
16
css
17.1 %
13
other
10.5 %
8
html
1.3 %
1
font
1.3 %
1
TOTAL
100%
76
Content size by domain
Domain
Percent
Size
vhealthprodapi.vhealth.io
47.2 %
2.41 Mb
vhealth.io
40.1 %
2.05 Mb
googletagmanager.com
5.7 %
296.16 Kb
maps.googleapis.com
3.2 %
168.43 Kb
fonts.gstatic.com
2.4 %
125.93 Kb
cdnjs.cloudflare.com
0.5 %
24.55 Kb
cdn.jsdelivr.net
0.5 %
23.86 Kb
google-analytics.com
0.4 %
20.85 Kb
googleads.g.doubleclick.net
0.0 %
1.82 Kb
fonts.googleapis.com
0.0 %
775 B
Other
0.0 %
1.21 Kb
TOTAL
100%
5.11 Mb
Requests by domain
Domain
Percent
Requests
vhealth.io
44.7 %
34
vhealthprodapi.vhealth.io
28.9 %
22
maps.googleapis.com
5.3 %
4
googletagmanager.com
5.3 %
4
google-analytics.com
5.3 %
4
fonts.googleapis.com
1.3 %
1
cdn.jsdelivr.net
1.3 %
1
cdnjs.cloudflare.com
1.3 %
1
googleads.g.doubleclick.net
1.3 %
1
stats.g.doubleclick.net
1.3 %
1
Other
3.9 %
3
TOTAL
100%
76
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test99% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 8.47 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

8.47 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img _ngcontent-ng-universal-demystified-c6="" class="img-fluid-baner" imagecacheresolve="" src="https://vhealthprodapi.vhealth.io/Images/24x7.jpg?..." alt="24x7.jpg">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.5. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.5004

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Find perfect health package for you and your family MB vHealth Silver Discover ...
Html: <section _ngcontent-ng-universal-demystified-c6="" class="slideShowBox">
Score: 0.2637
Server and security
Score: 86
Failed: 1
Warnings: 0
Passed: 9
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.vhealth.io" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.vhealth.io
Subject Alternative Names (SANs)
*.vhealth.io, vhealth.io
Not valid before
Tue, May 16o 2023, 10:33:59 am (z)
Not valid after
Sun, June 16o 2024, 10:33:59 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Go Daddy Secure Certificate Authority - G2
Intermediate certificate
Common name
Go Daddy Secure Certificate Authority - G2
Organization
GoDaddy.com, Inc.
Location
Scottsdale, Arizona, US
Not valid before
Tue, May 3o 2011, 7:00:00 am (z)
Not valid after
Sat, May 3o 2031, 7:00:00 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Go Daddy Root Certificate Authority - G2
Root certificate
Common name
Go Daddy Root Certificate Authority - G2
Organization
GoDaddy.com, Inc.
Location
Scottsdale, Arizona, US
Not valid before
Tue, September 1o 2009, 12:00:00 am (z)
Not valid after
Thu, December 31o 2037, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Go Daddy Root Certificate Authority - G2
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is not using the HTTP/2 protocol!
HSTS Test
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000; includesubdomains; preload
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 35
Failed: 5
Warnings: 0
Passed: 5
Structured Data Test59% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage is using the noindex meta tag! This means that it will be read but not indexed by search engines.
See results list
Canonical Tag Test95% of top 100 sites passed
  • We've found multiple canonical link tags. When more than one is specified, all canonical tags will be ignored!
<link href="http://www.vhealth.io/" rel="canonical"/>
<link href="https://www.vhealth.io/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • The robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test80% of top 100 sites passed
  • The request of ads.txt file has an unexpected Content-Type header: text/html; charset=utf-8. In order for this resource to be easily accessed by the DSPs and advertisers, its Content-Type header should be text/plain or text/plain; charset=utf-8.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved