vantarashop.com SEO Report | SEO Site Checkup

Pricing Free Tools Articles

Report generated 4 months ago

https://vantarashop.com

Your general SEO Checkup Score

Archived

78/100

SEO Score

Average SEO score of top 100 sites: 75%

This website received an SEO score of 78 out of 100, which is higher than the average score of 75. Our analysis has identified 13 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.

13 Failed

3 Warnings

57 Passed

Issues to fix

HIGH

H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.

HIGH

To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.

HIGH

Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.

HIGH

Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.

HIGH

Consider reducing the HTML size to improve loading times and retain visitors.

HIGH

By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.

MEDIUM

Serve properly sized images to reduce page loading times and to improve user's experience.

MEDIUM

Avoid using distorted images, as they can have a negative impact on the user experience.

MEDIUM

Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.

LOW

Using more than 20 HTTP requests on a webpage can negatively impact the loading time.

LOW

Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.

LOW

Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.

Common SEO issues

Score: 67

Failed: 5

Warnings: 2

Passed: 18

Meta Title Test100% of top 100 sites passed

This webpage is using a title tag with a length of 81 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.

Text: Vantara - Buy Luxury Glassware In India | Tumbler, Wine, Whiskey & Coffee Glasses

Length: 81 characters

Meta Description Test92% of top 100 sites passed

This webpage is using a meta description tag with a length of 232 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).

Text: Shop premium glassware online at Vantara! Explore a stunning collection of wine, whiskey, cocktail, coffee, and dessert glasses, tumblers, and bowls. Elevate your drinking experience with elegant designs. Fast shipping across India!

Length: 232 characters

Google Search Results Preview Test

Desktop version

https://vantarashop.com/Vantara - Buy Luxury Glassware In India | Tumbler, Wine, Whiskey & Coffee GlassesShop premium glassware online at Vantara! Explore a stunning collection of wine, whiskey, cocktail, coffee, and dessert glasses, tumblers, and bowls. Elevate your drinking experience with elegant designs. Fast shipping across India!

Mobile version

Most Common Keywords Test

There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.

56price35glasses28original28current19glass

Keywords Usage Test48% of top 100 sites passed

The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.

Keyword

Title tag

Meta description

Headings

price

glasses

original

current

glass

Keywords Cloud Test

addressartfulavailablebottlesbowlscartcashchampagneclassiccocktailcodecoffeecollectioncontactcookwarecouplecraftedcrystalcupscurrentcustomerdelightdeliverydeservedesigneddesignsdessertdiamonddiningdisclaimerdiscoverdrinkingdrinkwaredurabilityeleganceelegantelevateemailentertainingexperiencefaqsflasksfreeglassglassesglasswareguidelineshelphighhomeinfuserkitchenloginluxurymodernmugsoccasionorderoriginalpasswordperfectpersonalpolicypotspremiumpriceprintprivacyproductsqualityrefundsregisterreturnsromanticsearchservingshippingshopshoppingsippersspecialstrawstylestylishsundaessupporttoolstrackingtraveltumblertumblersunboxingupgradeusernamevantaraviewwelcomewhiskeywinewishlist

Competitor Domains Test

Heading Tags Test62% of top 100 sites passed

This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.

Elegance in Every Sip

Savor Every Layer

Serve Fresh in Style

Classic Martini Glasses | Elegant Stemware for Cocktails – Set of 6

Hexa Shape Golden Rim Whiskey Glasses – Set of 6

Elegant & Premium Champagne Flute Glasses – Set of 6

Premium Highball Pilsner Glasses for Mocktails, Cocktails, Juices – Set of 6

Luxury Brandy Snifter Glass | Crystal-Clear Cognac & Whiskey Glasses – Set of 6

Premium Twisted Crystal Whiskey Glasses- Set of 6

Hexa Diamond Whiskey Glasses | Hammered Glasses – Set of 6

Rotating Diamond Cut Whiskey Glasses – Set of 6

Diamond Cut Premium Whiskey Glasses – Set of 6

Diamond Shape Crystal Whiskey Glasses – Set of 6

Diamond Cut Whiskey Glasses – Set of 6

Diamond Cut Luxury Whiskey Glasses For Home Bar – Set of 6

Luxury Drinkware for Every Occasion

Stemmed Glass Dessert Bowl – Perfect for Sundaes & Splits

Perfect Dessert Glasses for Parties | Stylish Sundae & Trifle Bowls – Set of 6

Elegant Tall Falooda Glasses | Versatile Desserts Drinkware – Set of 2

Retro Stemmed Glass Sundaes & Splits Bowls – Set of 6

Travel Glass Tumbler with Infuser Lid, Handle, and Straw

Floarl Pattern Print Glass Iced Coffee/Tea Cup with Straw & Lid

Glass Detox Water Tumbler With Infuser Lid & Straw

Small Glass Mug with Straw – Green Glass & Ribbed Pattern

Crystal Embossed Glass Tumbler with Lid & Straw – Multicolor

Stylish Glass Coffee Cup with Heat-Resistant Sleeve, Lid & Straw

Cartoon Print Glass Sipper with Silicone Straw & Leak-Proof Lid

Cute Glass Tumbler with Dome Lid & Straw – Perfect for Drinks On-the-Go

Romantic Couple Mugs Set with “Mr.” & “Mrs.” Design For Coffee Lovers

Marble Ceramic Coffee Mugs with Golden Spoon | Mr & Mrs Cup

Luxury Mr. & Mrs. Ceramic Mug Set | Elegant Gold Print Couple Coffee Cups

Elegant Glass Ice Cream Bowls – Dessert Serving Cups – Set of 6

Robots.txt Test99% of top 100 sites passed

This website is using a robots.txt file.

https://vantarashop.com/robots.txt

Sitemap Test83% of top 100 sites passed

This website has a sitemap file.

https://vantarashop.com/sitemap_index.xml

SEO Friendly URL Test29% of top 100 sites passed

All links from this webpage are SEO friendly.

Image Alt Test78% of top 100 sites passed

This webpage is using "img" tags with empty or missing "alt" attribute!

Responsive Image Test29% of top 100 sites passed

Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.

Image Aspect Ratio Test75% of top 100 sites passed

Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!

Inline CSS Test10% of top 100 sites passed

This webpage is using inline CSS styles!

Deprecated HTML Tags Test94% of top 100 sites passed

This webpage does not use HTML deprecated tags.

Google Analytics Test72% of top 100 sites passed

This webpage is using Google Analytics.

Favicon Test100% of top 100 sites passed

This website appears to have a favicon.

Backlinks Test

JS Error Test83% of top 100 sites passed

There are no severe JavaScript errors on this webpage.

Console Errors Test27% of top 100 sites passed

This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.

Charset Declaration Test96% of top 100 sites passed

This webpage has a character encoding declaration.

Content-Type: text/html; charset=UTF-8

Speed optimizations

Score: 78

Failed: 5

Warnings: 0

Passed: 20

HTML Page Size Test23% of top 100 sites passed

The size of this webpage's HTML is 47.4 Kb, and is greater than the average size of 33 Kb! This can lead to slower loading times, lost visitors, and decreased revenue. Good steps to reduce HTML size include: using HTML compression, CSS layouts, external style sheets, and moving javascript to external files.

DOM Size Test56% of top 100 sites passed

The Document Object Model (DOM) of this webpage has 1,834 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.

HTML Compression/GZIP Test99% of top 100 sites passed

This webpage is successfully compressed using zstd compression on your code. The HTML code is compressed from 371.76 Kb to 47.4 Kb (87% size savings). This helps ensure a faster loading webpage and improved user experience.

Site Loading Speed Test71% of top 100 sites passed

The loading time of this webpage (measured from N. Virginia, US) is around 1.68 seconds and this is under the average loading speed which is 5 seconds.

JS Execution Time Test53% of top 100 sites passed

The JavaScript code used by this webpage is executed in less than 2 seconds.

Page Objects Test

This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!

Content size by content type

Content type

Percent

Size

image

67.7 %

1.80 Mb

javascript

14.5 %

395.32 Kb

font

11.5 %

311.75 Kb

html

3.6 %

97.56 Kb

css

2.7 %

73.52 Kb

other

0.0 %

557 B

Requests by content type

Content type

Percent

Requests

image

50.0 %

javascript

17.9 %

font

14.3 %

html

10.7 %

css

3.6 %

other

3.6 %

Content size by domain

Domain

Percent

Size

vantarashop.b-cdn.net

71.6 %

1.90 Mb

googletagmanager.com

13.3 %

362.35 Kb

fonts.gstatic.com

11.5 %

311.75 Kb

vantarashop.com

3.6 %

98.63 Kb

stats.g.doubleclick.net

0.0 %

557 B

Requests by domain

Domain

Percent

Requests

vantarashop.b-cdn.net

57.1 %

vantarashop.com

14.3 %

fonts.gstatic.com

14.3 %

googletagmanager.com

10.7 %

stats.g.doubleclick.net

3.6 %

Page Cache Test (Server Side Caching)100% of top 100 sites passed

This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.

Flash Test100% of top 100 sites passed

This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.

CDN Usage Test95% of top 100 sites passed

This webpage is serving all images, javascript and css resources from CDNs.

Modern Image Format Test43% of top 100 sites passed

This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.

Image Metadata Test72% of top 100 sites passed

This webpage is not using images with large metadata.

Image Caching Test95% of top 100 sites passed

This webpage is not using uncached images from same domain.

JavaScript Caching Test96% of top 100 sites passed

This webpage is using cache headers for all JavaScript resources.

CSS Caching Test98% of top 100 sites passed

This webpage is not using uncached CSS resources from same domain!

JavaScript Minification Test98% of top 100 sites passed

All JavaScript files used by this webpage are minified.

CSS Minification Test100% of top 100 sites passed

All CSS resources used by this webpage are minified.

Render Blocking Resources Test15% of top 100 sites passed

This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.

Nested Tables Test100% of top 100 sites passed

This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.

Frameset Test100% of top 100 sites passed

This webpage does not use frames.

Doctype Test100% of top 100 sites passed

This webpage has a doctype declaration.

<!DOCTYPE html>

URL Redirects Test97% of top 100 sites passed

This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).

Time To First Byte Test99% of top 100 sites passed

The Time To First Byte value of this webpage is 0.661 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.661 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed

The First Contentful Paint value of this webpage is 1.307 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

1.307 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed

The Largest Contentful Paint duration of this webpage is 2.06 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

2.06 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:

Cumulative Layout Shift Test91% of top 100 sites passed

The CLS score of this webpage is 0.0000. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

Server and security

Score: 97

Failed: 1

Warnings: 0

Passed: 9

URL Canonicalization Test93% of top 100 sites passed

https://vantarashop.com/ and https://www.vantarashop.com/ resolve to the same URL.

SSL Checker and HTTPS Test100% of top 100 sites passed

This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "vantarashop.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:

Server certificate

Common name

vantarashop.com

Subject Alternative Names (SANs)

vantarashop.com, *.vantarashop.com

Not valid before

Fri, January 31o 2025, 5:32:30 pm (z)

Not valid after

Thu, May 1o 2025, 6:29:51 pm (z)

Signature algorithm

ecdsaWithSha256

Issuer

WE1

Intermediate certificate

Common name

WE1

Organization

Google Trust Services

Location

Not valid before

Wed, December 13o 2023, 9:00:00 am (z)

Not valid after

Tue, February 20o 2029, 2:00:00 pm (z)

Signature algorithm

ecdsaWithSha384

Issuer

GTS Root R4

Root certificate

Common name

GTS Root R4

Organization

Google Trust Services LLC

Location

Not valid before

Wed, June 22o 2016, 12:00:00 am (z)

Not valid after

Sun, June 22o 2036, 12:00:00 am (z)

Signature algorithm

ecdsaWithSha384

Issuer

GTS Root R4

Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed

This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.

HTTP2 Test99% of top 100 sites passed

This webpage is using the HTTP/2 protocol.

HSTS Test84% of top 100 sites passed

This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.

Safe Browsing Test100% of top 100 sites passed

This website is not currently listed as suspicious (no malware or phishing activity found).

Server Signature Test95% of top 100 sites passed

The server signature is off for this webpage.

Directory Browsing Test100% of top 100 sites passed

Directory browsing is disabled for this website.

Plaintext Emails Test97% of top 100 sites passed

This webpage does not include email addresses in plaintext.

Unsafe Cross-Origin Links Test45% of top 100 sites passed

This webpage is not using target="_blank" links without rel="noopener" or rel="noreferrer" attribute.

Mobile usability

Score: 100

Failed: 0

Warnings: 0

Passed: 3

Meta Viewport Test92% of top 100 sites passed

This webpage is using a viewport meta tag.

<meta name="viewport" content="width=device-width, initial-scale=1, maximum-scale=5, viewport-fit=cover" />

Media Query Responsive Test98% of top 100 sites passed

This webpage is using CSS media queries, which is the base for responsive design functionalities.

Mobile Snapshot Test

Advanced SEO

Score: 67

Failed: 2

Warnings: 1

Passed: 7

Structured Data Test66% of top 100 sites passed

This webpage is using structured data.

Custom 404 Error Page Test80% of top 100 sites passed

This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.

Noindex Tag Test99% of top 100 sites passed

This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.

Canonical Tag Test93% of top 100 sites passed

This webpage is using the canonical link tag. This tag specifies that the URL: https://vantarashop.com/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.

<link href="https://vantarashop.com/" rel="canonical"/>

Nofollow Tag Test

This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.

Disallow Directive Test

Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).

Meta Refresh Test98% of top 100 sites passed

This webpage is not using a meta refresh tag.

SPF Records Test94% of top 100 sites passed

This DNS server is using an SPF record.

v=spf1 include:zohomail.in ~all

Ads.txt Validation Test67% of top 100 sites passed

This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.

Spell Check Test

Report generated 4 months ago

https://vantarashop.com

Your general SEO Checkup Score

Archived

78/100

SEO Score

Average SEO score of top 100 sites: 75%

13 Failed

3 Warnings

57 Passed

Issues to fix

HIGH

H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.

HIGH

To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.

HIGH

Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.

HIGH

Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.

HIGH

Consider reducing the HTML size to improve loading times and retain visitors.

HIGH

By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.

MEDIUM

Serve properly sized images to reduce page loading times and to improve user's experience.

MEDIUM

Avoid using distorted images, as they can have a negative impact on the user experience.

MEDIUM

LOW

Using more than 20 HTTP requests on a webpage can negatively impact the loading time.

LOW

Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.

LOW

Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.

Website SEO, Monitoring & Automation Made Easy.

Product

Pricing
Free Tools
Articles
Login
Free 7-Day Trial

Company

Legal

Find the keywords where this URL is listed in the top 20 results of Google's organic listings.

Understand your competitors' SEO and backlink profile

Get a full and detailed list of your backlinks!

Accurate loading speed and website loading speed monitor

Check your webpage for misspellings!