seo site checkup logo
PricingFree ToolsArticles
Report generated a year ago
https://unkind.info
Your general SEO Checkup Score
Archived
73/100
SEO Score
Average SEO score of top 100 sites: 74%
This website received an SEO score of 73 out of 100, which is below the average score of 74. However, there are 17 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
17 Failed
2 Warnings
53 Passed
Issues to fix
HIGH
It is recommended to avoid URL parameters and to use hyphens to separate words in the URL structure, rather than underscores.
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
A proper character encoding declaration ensures that all characters, including non-ASCII characters, are displayed correctly in the browser, improving the readability and usability of the webpage.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 55
Failed: 7
Warnings: 2
Passed: 17
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 71 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: TẢI GAME & ỨNG DỤNG MOD 2023 cho Android APK & IPhone IOS - UNKIND.INFO
Length: 71 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 104 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Tải games & ứng dụng apps apk, mod, hack 2023 cho Android APK & IPhone IOS. UNKIND.INFO free download...
Length: 104 characters
Google Search Results Preview Test
Desktop version
https://unkind.info/TẢI GAME & ỨNG DỤNG MOD 2023 cho Android APK & IPhone IOS - UNKIND.INFOTải games & ứng dụng apps apk, mod, hack 2023 cho Android APK & IPhone IOS. UNKIND.INFO free download...
Mobile version
https://unkind.info/TẢI GAME & ỨNG DỤNG MOD 2023 cho Android APK & IPhone IOS - UNKIND.INFOTải games & ứng dụng apps apk, mod, hack 2023 cho Android APK & IPhone IOS. UNKIND.INFO free download...
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
vi_VN
og:type
website
og:title
Download games, apps APK/MOD/HACK for Android phones & IPhone IOS
og:description
Download games & apps apk, mod, hack for Android & IPhone IOS phones. Safely censored. Free high speed download.
og:url
https://unkind.info/
og:site_name
UNKIND.INFO
og:image
https://unkind.info/wp-content/uploads/2022/09/home.jpg
og:image:width
730
og:image:height
426
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
12chơi12dụng12miễn12nhất10free
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
chơi
dụng
miễn
nhất
free
Keywords Cloud Test
addthisarrssalayalaballbharatbigobluebosscarloscashcellchuyênchơiclassiccolorcoloringcommandoconnectconstellationdefensedemondicedraughtsdrawdrivingdunkdụngelefantentertainmentexperimentfreefruitgamegamesgartengiãnherohomehànghànhidlekingkiếmkocmolotkrakenlevellightlockloopluckyludoluismahjongmastermatchmaverickmechamergemiễnmodernmonsternhấtnoornumberofficepadillaphongpuzzleraftrealrecreationsroyalroyalerwardsscienceshekreeskinslayersmaysnipersolitairestarlinkstomacostudentsstudiotavlatheothuongthầntiềntoolstreasuretriplevalvivietwarfarewindwordyatzy지렁이의
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test40% of top 100 sites passed
  • This webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test71% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a meta charset tag but is not fully contained in the first 1024 bytes of the HTML document! The element containing the character encoding declaration must be serialized completely within the first 1024 bytes of the document, otherwise it can significantly affect load performance.
Social Media Test80% of top 100 sites passed
  • This webpage is connected successfully with social media using:
AddThis 
Speed optimizations
Score: 81
Failed: 5
Warnings: 0
Passed: 18
HTML Page Size Test34% of top 100 sites passed
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,108 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 552.09 Kb to 145.79 Kb (74% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 0.61 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
87.0 %
6.30 Mb
javascript
8.7 %
647.65 Kb
html
1.7 %
122.52 Kb
font
1.5 %
108.62 Kb
css
1.0 %
77.23 Kb
other
0.2 %
12.65 Kb
TOTAL
100%
7.25 Mb
Requests by content type
Content type
Percent
Requests
image
42.2 %
38
javascript
27.8 %
25
html
12.2 %
11
css
10.0 %
9
other
4.4 %
4
font
3.3 %
3
TOTAL
100%
90
Content size by domain
Domain
Percent
Size
unkind.info
87.3 %
6.33 Mb
s7.addthis.com
4.0 %
296.87 Kb
pagead2.googlesyndication.com
3.6 %
266.21 Kb
tpc.googlesyndication.com
1.3 %
97.48 Kb
ka-f.fontawesome.com
1.3 %
96.14 Kb
googleads.g.doubleclick.net
1.1 %
82.21 Kb
googletagservices.com
0.7 %
48.97 Kb
fonts.gstatic.com
0.4 %
31.50 Kb
gstatic.com
0.2 %
15.43 Kb
fonts.googleapis.com
0.0 %
2.57 Kb
Other
0.1 %
6.71 Kb
TOTAL
100%
7.25 Mb
Requests by domain
Domain
Percent
Requests
unkind.info
41.1 %
37
pagead2.googlesyndication.com
11.1 %
10
tpc.googlesyndication.com
11.1 %
10
s7.addthis.com
7.8 %
7
googleads.g.doubleclick.net
5.6 %
5
ka-f.fontawesome.com
4.4 %
4
fonts.googleapis.com
3.3 %
3
gstatic.com
3.3 %
3
m.addthis.com
2.2 %
2
adservice.google.com
2.2 %
2
Other
7.8 %
7
TOTAL
100%
90
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test99% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is not using render-blocking resources.
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 1.35 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.35 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img alt="Bắn Cá Thần Tài Mới MOD – HACK" class="lazy loaded" data-was-processed="true" src="https://unkind.info/wp-content/uploads/2023/03/220..." style="display: block;">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.005. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.0045

0.1

0.25

DOM element which contributes the most to CLS score:
Html: <ins class="adsbygoogle adsbygoogle-noablate" data-adsbygoogle-status="done" style="display: block; width: 100% !important; height: 12..." data-anchor-status="displayed" data-ad-status="filled" data-anchor-shown="true">
Score: 0.0006
Server and security
Score: 90
Failed: 2
Warnings: 0
Passed: 8
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "unkind.info" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.unkind.info
Subject Alternative Names (SANs)
*.unkind.info, unkind.info
Not valid before
Tue, February 28o 2023, 5:54:24 am (z)
Not valid after
Mon, May 29o 2023, 5:54:23 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GTS CA 1P5
Intermediate certificate
Common name
GTS CA 1P5
Organization
Google Trust Services LLC
Location
US
Not valid before
Thu, August 13o 2020, 12:00:42 am (z)
Not valid after
Thu, September 30o 2027, 12:00:42 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GTS Root R1
Root certificate
Common name
GTS Root R1
Organization
Google Trust Services LLC
Location
US
Not valid before
Wed, June 22o 2016, 12:00:00 am (z)
Not valid after
Sun, June 22o 2036, 12:00:00 am (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
GTS Root R1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0, minimum-scale=1.0, maximum-scale=1.0" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 62
Failed: 3
Warnings: 0
Passed: 7
Structured Data Test59% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://unkind.info/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://unkind.info/" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test80% of top 100 sites passed
  • This website is using an Authorized Digital Sellers (ads.txt) file and its content has a valid format. Since the file is uploaded and maintained by publishers on their own domain, it's not easy for bad players to gain access to it or to change entries. Buyers who want to bid on the publisher's inventory can refer to their ads.txt file and confidently know that the exchange they are dealing with is in fact authorized to directly or indirectly sell the publisher's inventory.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2024 • All rights reserved