seo site checkup logo
PricingFree ToolsArticles
Report generated a year ago
https://universitykart.com/course/coursedetails/master-of-business-administration
Your general SEO Checkup Score
Archived
73/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 73 out of 100, which is below the average score of 75. However, there are 14 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
14 Failed
5 Warnings
53 Passed
Issues to fix
HIGH
To provide a good user experience, Google recommends that sites should aim for a Cumulative Layout Shift score of 0.1 or less.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a First Contentful Paint value of 1.8 seconds or less.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
Common SEO issues
Score: 82
Failed: 2
Warnings: 3
Passed: 20
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 84 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: MBA: Master of Business Administration, Admissions 2024, Fees, Syllabus, Exams, Jobs
Length: 84 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Know all about Full Form of MBA Courses, Eligibility, Admission 2024, Fees, Syllabus, Subjects, Specialisations, Exams, Placements, Jobs and Salary, and Top MBA colleges in India.
Length: 179 characters
Google Search Results Preview Test
Desktop version
https://universitykart.com/course/coursedetails/master-of-business-administrationMBA: Master of Business Administration, Admissions 2024, Fees, Syllabus, Exams, JobsKnow all about Full Form of MBA Courses, Eligibility, Admission 2024, Fees, Syllabus, Subjects, Specialisations, Exams, Placements, Jobs and Salary, and Top MBA colleges in India.
Mobile version
https://universitykart.com/course/coursedetails/master-of-business-administrationMBA: Master of Business Administration, Admissions 2024, Fees, Syllabus, Exams, JobsKnow all about Full Form of MBA Courses, Eligibility, Admission 2024, Fees, Syllabus, Subjects, Specialisations, Exams, Placements, Jobs and Salary, and Top MBA colleges in India.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:title
MBA: Master of Business Administration, Admissions 2024, Fees, Syllabus, Exams, Jobs
og:url
https://universitykart.com/course/coursedetails/master-of-business-administration
og:type
website
og:description
Know all about Full Form of MBA Courses, Eligibility, Admission 2024, Fees, Syllabus, Subjects, Specialisations, Exams, Placements, Jobs and Salary, and Top MBA colleges in India.
og:image
https://universitykart.b-cdn.net/Content/images/course_level_default_image.jpeg
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
132management78university73business61college46course
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
management
university
business
college
course
Keywords Cloud Test
administrationadmissionahmedabadamityanalyticsanswerapplyaveragebachelorbangalorebankbankingbasedbestbusinesscalcuttacandidatescareercollegecollegescompletingcoursecoursescriteriadegreedelhidifferentdigitaldiplomadistancedurationeducationeligibilityengineeringentranceentrepreneurshipexamexamsexecutivefeesfieldfinancefinancialformgeneralgovernmentgraduategraduatesgraduationgrouphavehealthcarehospitalhumanindiainstituteinsuranceinternationaljobslakhleadershiplevelmanagementmanagermarketingmastermumbainationalonlineoperationsopportunitiespgdmpharmacypostpostgraduateprivateprofessionalsprogramprogramspursuerangerecognizedregularrequiredresourcesschoolscienceskillsspecializationspecializationsstatestudentstechtechnologytimeuniversitiesuniversityvariousyearyears
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
MBA (Masters of Business Administration)
H2 tags
MBA: Full-Form, Admission 2024, Eligibility, Exams, Syllabus, Fees, Jobs, Top Colleges, Other Specializations
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
SEO Friendly URL Test25% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test28% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test8% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test41% of top 100 sites passed
  • This webpage has some warnings caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Social Media Test57% of top 100 sites passed
  • This webpage is connected successfully with social media using:
FacebookĀ TwitterĀ 
Speed optimizations
Score: 63
Failed: 7
Warnings: 2
Passed: 16
HTML Page Size Test21% of top 100 sites passed
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,288 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 650.73 Kb to 408.26 Kb (37% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 7.3 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
html
33.5 %
405.73 Kb
javascript
32.5 %
393.27 Kb
image
16.0 %
193.30 Kb
font
11.6 %
140.14 Kb
css
6.5 %
78.38 Kb
other
0.0 %
503 B
TOTAL
100%
1.18 Mb
Requests by content type
Content type
Percent
Requests
image
41.4 %
24
javascript
31.0 %
18
css
17.2 %
10
font
5.2 %
3
other
3.4 %
2
html
1.7 %
1
TOTAL
100%
58
Content size by domain
Domain
Percent
Size
universitykart.com
33.9 %
410.54 Kb
universitykart.b-cdn.net
25.8 %
312.29 Kb
googletagmanager.com
14.7 %
178.57 Kb
use.fontawesome.com
7.1 %
85.88 Kb
cdnjs.cloudflare.com
6.4 %
77.57 Kb
fonts.gstatic.com
5.5 %
66.53 Kb
cdn.jsdelivr.net
4.1 %
49.43 Kb
google-analytics.com
1.7 %
20.80 Kb
static.cloudflareinsights.com
0.6 %
6.94 Kb
fonts.googleapis.com
0.2 %
2.26 Kb
Other
0.0 %
503 B
TOTAL
100%
1.18 Mb
Requests by domain
Domain
Percent
Requests
universitykart.b-cdn.net
63.8 %
37
cdnjs.cloudflare.com
6.9 %
4
universitykart.com
5.2 %
3
cdn.jsdelivr.net
3.4 %
2
fonts.googleapis.com
3.4 %
2
use.fontawesome.com
3.4 %
2
fonts.gstatic.com
3.4 %
2
googletagmanager.com
3.4 %
2
static.cloudflareinsights.com
1.7 %
1
analytics.google.com
1.7 %
1
Other
3.4 %
2
TOTAL
100%
58
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test97% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test97% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test96% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test96% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test98% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 1.611 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

1.611 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 3.859 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

3.859 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 3.86 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

3.86 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: The average MBA salary in India ranges fromĀ INR 7 LPA to INR 15 LPA, depending o...
Html: <p style="text-align: justify;">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.2747. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.2747

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Table of Contents Highlights - MBA Course Details What is a MBA (Master of Busin...
Html: <div class="tab-content">
Score: 0.2723
Server and security
Score: 90
Failed: 2
Warnings: 0
Passed: 8
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "universitykart.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.universitykart.com
Subject Alternative Names (SANs)
*.universitykart.com, universitykart.com
Not valid before
Mon, November 20o 2023, 9:50:02 am (z)
Not valid after
Sat, December 21o 2024, 9:50:01 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
AlphaSSL CA - SHA256 - G4
Intermediate certificate
Common name
AlphaSSL CA - SHA256 - G4
Organization
GlobalSign nv-sa
Location
BE
Not valid before
Wed, October 12o 2022, 3:49:43 am (z)
Not valid after
Tue, October 12o 2027, 12:00:00 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GlobalSign Root CA
Root certificate
Common name
GlobalSign Root CA
Organization
GlobalSign nv-sa
Location
BE
Not valid before
Tue, September 1o 1998, 12:00:00 pm (z)
Not valid after
Fri, January 28o 2028, 12:00:00 pm (z)
Signature algorithm
sha1WithRsaEncryption
Issuer
GlobalSign Root CA
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test82% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=0
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test98% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test100% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1, shrink-to-fit=no" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 35
Failed: 3
Warnings: 0
Passed: 6
Structured Data Test53% of top 100 sites passed
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
<link href="https://universitykart.com/course/coursedetails/master-of-business-administration" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:_spf.google.com include:spf.sn1.migomta.one ~all
Ads.txt Validation Test68% of top 100 sites passed
  • The request of ads.txt file has an unexpected Content-Type header: text/html; charset=utf-8. In order for this resource to be easily accessed by the DSPs and advertisers, its Content-Type header should be text/plain or text/plain; charset=utf-8.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved