seo site checkup logo
PricingFree ToolsArticles
Report generated 3 years ago
https://unipune.ac.in
Your general SEO Checkup Score
Archived
44/100
SEO Score
Average SEO score of top 100 sites: 75%
Unfortunately, this webpage received an SEO score of 44 out of 100, which is significantly lower than the average score of 75. Our analysis has identified 35 SEO issues that need to be addressed urgently to improve your website's performance and avoid further damage to your search engine visibility.
35 Failed
4 Warnings
30 Passed
Common SEO issues
Score: 33
Failed: 10
Warnings: 3
Passed: 9
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 95 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Savitribai Phule Pune University, One of the Premier Universities in India - Official Website.
Length: 95 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 450 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: University of Pune, one of the premier universities in India, is positioned in the North-western part of Pune city. It occupies an area of about 411 acres. It was established on 10th February, 1948 under the Poona University Act. The university houses 46 academic departments. It is popularly known as the 'Oxford of the East'. It has about 118 recognized research institutes and 269 affiliated colleges offering graduate and under-graduate courses.
Length: 450 characters
Google Search Results Preview Test
Desktop version
https://unipune.ac.inSavitribai Phule Pune University, One of the Premier Universities in India - Official Website.University of Pune, one of the premier universities in India, is positioned in the North-western part of Pune city. It occupies an area of about 411 acres. It was established on 10th February, 1948 under the Poona University Act. The university houses 46 academic departments. It is popularly known as the 'Oxford of the East'. It has about 118 recognized research institutes and 269 affiliated colleges offering graduate and under-graduate courses.
Mobile version
https://unipune.ac.inSavitribai Phule Pune University, One of the Premier Universities in India - Official Website.University of Pune, one of the premier universities in India, is positioned in the North-western part of Pune city. It occupies an area of about 411 acres. It was established on 10th February, 1948 under the Poona University Act. The university houses 46 academic departments. It is popularly known as the 'Oxford of the East'. It has about 118 recognized research institutes and 269 affiliated colleges offering graduate and under-graduate courses.
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
34sppu12university7chancellor5learning5education
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
sppu
university
chancellor
learning
education
Keywords Cloud Test
academicacademicsaccountsachievementsadministrationadmissionadmissionsalumniannouncementsariiaassociationatalavailavailablebrowserbusinesscalendarcentrecertificatechancellorchannelcircularsconfiguredcontactcontentcopyrightcornercoursescurrentlydepartmentsdevelopmentdigilockerdisplaydistancedoeseducationexaminationexclusivefeedbackfellowshipfinancefloodfoundationframesgovernorharvardhigherhomehumaninformationinlineinnovationinstitutionsinternationallearninglibrarylimitedlinkslistmaharashtranewsnirfonlineopeningspeoplephulepressprocurementpunequalityrankingreleasesresearchrightssavitribaischolarshipsschoolsearchseatssectionshrisitemapspecialsportssppustandsstudentstudentssupportsyllabitelegramtendersuniversitiesuniversityusefulvicevidyavaniviewwebmailwebsite
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
Robots.txt Test94% of top 100 sites passed
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test75% of top 100 sites passed
  • This website lacks a sitemap file! Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • We found some HTML deprecated tags! You are advised to change these old tags with equivalent tags or proper CSS rules.
14font
Google Analytics Test69% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
meta content="text/html; charset=windows-1252" http-equiv="Content-Type"
Speed optimizations
Score: 49
Failed: 10
Warnings: 1
Passed: 7
HTML Page Size Test34% of top 100 sites passed
  • The size of this webpage's HTML is 18.18 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,319 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 109.92 Kb to 18.18 Kb (83% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 12.08 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
98.1 %
8.37 Mb
javascript
1.6 %
144.18 Kb
html
0.2 %
19.24 Kb
css
0.1 %
6.07 Kb
font
0.0 %
0 B
other
0.0 %
0 B
TOTAL
100%
8.54 Mb
Requests by content type
Content type
Percent
Requests
image
83.0 %
88
javascript
10.4 %
11
css
3.8 %
4
html
2.8 %
3
font
0.0 %
0
other
0.0 %
0
TOTAL
100%
106
Content size by domain
Domain
Percent
Size
unipune.ac.in
99.4 %
8.48 Mb
code.jquery.com
0.4 %
30.68 Kb
cdn.jsdelivr.net
0.3 %
24.08 Kb
design14.volusion.com
0.0 %
1.63 Kb
TOTAL
100%
8.54 Mb
Requests by domain
Domain
Percent
Requests
unipune.ac.in
97.2 %
103
cdn.jsdelivr.net
0.9 %
1
code.jquery.com
0.9 %
1
design14.volusion.com
0.9 %
1
TOTAL
100%
106
CDN Usage Test96% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test99% of top 100 sites passed
See results list
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is not using cache headers for JavaScript resources! Setting cache headers can help to speed up the webpage for returning users.
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using cache headers for CSS resources! Setting cache headers can help to speed up the webpage for returning users.
See results list
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test96% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 12.08 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

12.08 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img src="uop_files/Bannerimage/1.jpg">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.005. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.0049

0.1

0.25

DOM element which contributes the most to CLS score:
Text: University Ranking SPPU "The University stands for humanism and tolerance, ...
Html: <tr>
Score: 0.0025
Server and security
Score: 5
Failed: 6
Warnings: 0
Passed: 1
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is using an invalid SSL certificate! Modern browsers will block insecure connections and will mark the website as not secure so that the visitors will not see the website content. Having a valid SSL certificate is an important security practice to ensure that your website is safe and provides trust, and any communication between the user's browser and your website (such as passwords, credit cards, or forms) is encrypted and private.

The certificate is not used before the activation date.

The certificate has expired!

The hostname "unipune.ac.in" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.unipune.ac.in
Subject Alternative Names (SANs)
*.unipune.ac.in, unipune.ac.in
Not valid before
Tue, July 7o 2020, 12:00:00 am (z)
Not valid after
Fri, July 8o 2022, 12:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
RapidSSL RSA CA 2018
Root certificate
Common name
RapidSSL RSA CA 2018
Organization
DigiCert Inc
Location
US
Not valid before
Mon, November 6o 2017, 12:23:33 pm (z)
Not valid after
Sat, November 6o 2027, 12:23:33 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
DigiCert Global Root CA
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage is using mixed content! While the initial HTML is loaded over a secure HTTPS connection, other resources (such as images, videos, stylesheets, scripts) may be loaded over an insecure HTTP connection, which may result in blocked content or unexpected page behavior.
See results list
HTTP2 Test92% of top 100 sites passed
  • This webpage is not using the HTTP/2 protocol!
HSTS Test
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Plaintext Emails Test93% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 0
Failed: 2
Warnings: 0
Passed: 1
Meta Viewport Test94% of top 100 sites passed
  • This webpage does not have a viewport meta tag! Add a viewport meta tag to optimize your webpage for mobile screens.
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is not using CSS media queries. We recommend the use of this technique in order to implement responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 36
Failed: 2
Warnings: 0
Passed: 6
Structured Data Test59% of top 100 sites passed
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
See results list
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 mx a ip4:196.1.114.97 ip4:196.1.114.24 ip4:196.1.114.42 ~all

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved