seo site checkup logo
PricingFree ToolsArticles
Report generated 3 years ago
https://twitter.com/_danielberanek
Your general SEO Checkup Score
Archived
67/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 67 out of 100, which is below the average score of 75. However, there are 18 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
18 Failed
3 Warnings
49 Passed
Common SEO issues
Score: 52
Failed: 8
Warnings: 2
Passed: 15
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 71 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: SEO specialista a copywriter Daniel Beránek (@_danielberanek) / Twitter
Length: 71 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is not using a meta description tag! You should include this tag in order to provide a brief description of your page which can be used by search engines. Well-written and inviting meta descriptions may also help click-through rates to your site in search engine results.
Google Search Results Preview Test
Desktop version
https://twitter.com/_danielberanekSEO specialista a copywriter Daniel Beránek (@_danielberanek) / Twitter
Mobile version
https://twitter.com/_danielberanekSEO specialista a copywriter Daniel Beránek (@_danielberanek) / Twitter
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:site_name
Twitter
og:type
profile
og:url
https://twitter.com/_danielberanek
og:description
#SEO a #copy s ostrými hroty
og:image
https://pbs.twimg.com/profile_images/1511319946986496000/69qczJSA_normal.jpg
og:title
SEO specialista a copywriter Daniel Beránek (@_danielberanek) / Twitter
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
9specialista9copywriter9daniel9beránek8tweets
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
specialista
copywriter
daniel
beránek
tweets
Keywords Cloud Test
abychomadvertisingagencyaplikaceavailableberánekbrnobrowserbrowsersburinkycenterchceclickcontinuecookiecopycopywriterczechdanieldanielberanekdescriptiondetecteddisableddomudostredivychdostředivýchdosáhlienableexplorefollowfollowersfollowinghappeninghelphospoděhrotyhttpsimageimprintinfojavascriptjejichjentakdobryslovajoinedjsemjustkdyžklimaknowlikeslistmarketingmediamissmámemůžemenásobněodstredivychodstředivýchorientaceostrýmipeoplepolicypomůžuprimaprivacyreadrepliesrepublicrichtercoatingsseospecialistaacopywriterdanielberanekservicesettingssignsoucetsoucinusoučetsoučinůspecialistasplitsignalhqstatessupportedswitchtermstomutrendingtrysektryskovypohontweetstwitterucinnostunitedusingvodyvyběhlvyššívíceyoutuzkombinovatzvláštní
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
JavaScript is not available.
SEO specialista a copywriter Daniel Beránek’s Tweets
Trending now
H2 tags
SEO specialista a copywriter Daniel Beránek
New to Twitter?
You might like
What’s happening
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • This website has a sitemap file.
SEO Friendly URL Test40% of top 100 sites passed
  • This webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test33% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Social Media Test80% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Twitter 
Speed optimizations
Score: 72
Failed: 6
Warnings: 1
Passed: 16
HTML Page Size Test34% of top 100 sites passed
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,984 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 310.88 Kb to 51.34 Kb (83% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 0.99 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 2 seconds!
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
76.9 %
1.98 Mb
image
9.0 %
238.50 Kb
font
8.6 %
226.50 Kb
html
2.9 %
76.57 Kb
other
2.6 %
69.26 Kb
css
0.0 %
585 B
TOTAL
100%
2.58 Mb
Requests by content type
Content type
Percent
Requests
javascript
55.4 %
56
other
21.8 %
22
image
13.9 %
14
font
5.0 %
5
html
3.0 %
3
css
1.0 %
1
TOTAL
100%
101
Content size by domain
Domain
Percent
Size
abs.twimg.com
80.2 %
2.07 Mb
pbs.twimg.com
8.9 %
236.39 Kb
accounts.google.com
4.4 %
115.23 Kb
api.twitter.com
2.5 %
67.17 Kb
twitter.com
1.4 %
37.99 Kb
fonts.gstatic.com
1.0 %
27.42 Kb
google-analytics.com
0.8 %
19.96 Kb
appleid.cdn-apple.com
0.7 %
17.32 Kb
abs-0.twimg.com
0.1 %
2.11 Kb
TOTAL
100%
2.58 Mb
Requests by domain
Domain
Percent
Requests
abs.twimg.com
57.4 %
58
api.twitter.com
20.8 %
21
pbs.twimg.com
11.9 %
12
accounts.google.com
4.0 %
4
abs-0.twimg.com
2.0 %
2
twitter.com
1.0 %
1
appleid.cdn-apple.com
1.0 %
1
fonts.gstatic.com
1.0 %
1
google-analytics.com
1.0 %
1
TOTAL
100%
101
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test99% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is not using render-blocking resources.
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 9.01 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

9.01 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<div class="css-1dbjc4n r-1niwhzg r-vvn4in r-u6sd8q r-4gszlv r..." style="background-image: url("https://pbs.twimg.com/media...">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.096. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.0956

0.1

0.25

DOM element which contributes the most to CLS score:
Text: SEO specialista a copywriter Daniel Beránek 400 Tweets See new Tweets Follow SEO...
Html: <main role="main" class="css-1dbjc4n r-1habvwh r-16y2uox r-1wbh5a2">
Score: 0.0597
Server and security
Score: 100
Failed: 0
Warnings: 0
Passed: 10
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "twitter.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
twitter.com
Organization
Twitter, Inc.
Location
San Francisco, California, US
Subject Alternative Names (SANs)
twitter.com, www.twitter.com
Not valid before
Mon, November 14o 2022, 12:00:00 am (z)
Not valid after
Tue, November 14o 2023, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
DigiCert TLS RSA SHA256 2020 CA1
Intermediate certificate
Common name
DigiCert TLS RSA SHA256 2020 CA1
Organization
DigiCert Inc
Location
US
Not valid before
Wed, April 14o 2021, 12:00:00 am (z)
Not valid after
Sun, April 13o 2031, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
DigiCert Global Root CA
Root certificate
Common name
DigiCert Global Root CA
Organization
DigiCert Inc
Location
US
Not valid before
Fri, November 10o 2006, 12:00:00 am (z)
Not valid after
Mon, November 10o 2031, 12:00:00 am (z)
Signature algorithm
sha1WithRsaEncryption
Issuer
DigiCert Global Root CA
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=631138519
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 50
Failed: 1
Warnings: 0
Passed: 2
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width,initial-scale=1,maximum-scale=1,user-scalable=0,viewport-fit=cover" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is not using CSS media queries. We recommend the use of this technique in order to implement responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 58
Failed: 3
Warnings: 0
Passed: 6
Structured Data Test59% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • We've found multiple canonical link tags. When more than one is specified, all canonical tags will be ignored!
<link href="https://twitter.com/_danielberanek" rel="canonical"/>
<link data-rh="true" href="https://twitter.com/_danielberanek" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 ip4:199.16.156.0/22 ip4:199.59.148.0/22 ip4:8.25.194.0/23 ip4:8.25.196.0/23 ip4:204.92.114.203 ip4:204.92.114.204/31 ip4:54.156.255.69 include:_spf.google.com include:_thirdparty.twitter.com include:spf.smtp2go.com -all
Ads.txt Validation Test80% of top 100 sites passed
  • This website is using an Authorized Digital Sellers (ads.txt) file and its content has a valid format. Since the file is uploaded and maintained by publishers on their own domain, it's not easy for bad players to gain access to it or to change entries. Buyers who want to bid on the publisher's inventory can refer to their ads.txt file and confidently know that the exchange they are dealing with is in fact authorized to directly or indirectly sell the publisher's inventory.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved