seo site checkup logo
PricingFree ToolsArticles
Report generated 3 years ago
https://tukar.co.id
Your general SEO Checkup Score
Archived
72/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 72 out of 100, which is below the average score of 75. However, there are 14 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
14 Failed
3 Warnings
51 Passed
Common SEO issues
Score: 71
Failed: 5
Warnings: 2
Passed: 18
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 62 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Jasa Tukar Pulsa 24 Jam Convert Pulsa Otomatis - Convert Pulsa
Length: 62 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 140 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Jasa convert pulsa dan tukar pulsa ke dana, gopay, ovo, shopeepay proses mudah hanya hitungan detik dan sistem otomatis. Buka 24 jam nonstop
Length: 140 characters
Google Search Results Preview Test
Desktop version
https://tukar.co.idJasa Tukar Pulsa 24 Jam Convert Pulsa Otomatis - Convert PulsaJasa convert pulsa dan tukar pulsa ke dana, gopay, ovo, shopeepay proses mudah hanya hitungan detik dan sistem otomatis. Buka 24 jam nonstop
Mobile version
https://tukar.co.idJasa Tukar Pulsa 24 Jam Convert Pulsa Otomatis - Convert PulsaJasa convert pulsa dan tukar pulsa ke dana, gopay, ovo, shopeepay proses mudah hanya hitungan detik dan sistem otomatis. Buka 24 jam nonstop
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:title
JASA CONVERT PULSA TERPERCAYA
og:description
Jasa convert pulsa dan tukar pulsa ke dana, gopay, ovo, shopeepay proses mudah hanya hitungan detik dan sistem otomatis. Buka 24 jam nonstop
og:url
https://tukar.co.id
og:image
https://user-images.githubusercontent.com/39829514/168779658-6de86437-07ce-485e-94bf-2bfe993b859f.png
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
14dana13kami11pulsa11topup11sukses
Keywords Usage Test81% of top 100 sites passed
  • This webpage is using the most common keywords in the meta-tags. This helps search engines to properly identify the topic of this webpage.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
aktifitasamanandaapakanaxisbagaiamanabatasanberapaberkomitmenbukticanggihcaracepatconvertdanadapatdengandetikdiajukandijamindipahamiformgopayhalamanhanyaharihitunganhubungiindosatjasajutakamikerjanyaklikkonfirmasilalulayananlimitlinkajamaksimalmasukanmelayanimemberikanmemudahkanmenawarkanmenerimamenitminimalmisalmudahmungkinnomernominaloperatoropratorotomatispembelianpertanyaanpertukaranpilihprodukprosespulsarateribetribusaldosangatsebaikselulerseringsetiapshoeepayshopeeshopeepaysilahkansistemsmartfrenstopsubmitsuksestanpatelkomselterjaditerupdatetestimonitidaktinggitomboltopuptransaksitransfertukartutorialuangubahulanguntukwaityang
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Hubungi Kami
H2 tags
Jasa tukar pulsa 24 jam sistem otomatis - Convert pulsa
Pembelian Produk
Konfirmasi pembayaran
Robots.txt Test94% of top 100 sites passed
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test75% of top 100 sites passed
  • This website lacks a sitemap file! Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
SEO Friendly URL Test40% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test80% of top 100 sites passed
  • This webpage is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 69
Failed: 5
Warnings: 1
Passed: 16
HTML Page Size Test34% of top 100 sites passed
  • The size of this webpage's HTML is 18.56 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,587 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 111.79 Kb to 18.56 Kb (83% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage is around 6.32 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage has less than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from the server, which will ultimately slow down the loading of your webpage.
Content size by content type
Content type
Percent
Size
javascript
71.1 %
1.04 Mb
font
12.7 %
189.15 Kb
css
10.7 %
160.40 Kb
image
3.9 %
58.06 Kb
html
1.1 %
16.59 Kb
other
0.6 %
8.61 Kb
TOTAL
100%
1.46 Mb
Requests by content type
Content type
Percent
Requests
javascript
36.8 %
7
font
26.3 %
5
css
15.8 %
3
other
10.5 %
2
html
5.3 %
1
image
5.3 %
1
TOTAL
100%
19
Content size by domain
Domain
Percent
Size
tukar.co.id
89.3 %
1.30 Mb
googletagmanager.com
4.9 %
72.67 Kb
wss.gopulsa.co.id:6001
4.1 %
61.54 Kb
fonts.gstatic.com
1.6 %
23.92 Kb
fonts.googleapis.com
0.1 %
1.02 Kb
google-analytics.com
0.0 %
303 B
TOTAL
100%
1.46 Mb
Requests by domain
Domain
Percent
Requests
tukar.co.id
63.2 %
12
fonts.gstatic.com
15.8 %
3
fonts.googleapis.com
5.3 %
1
googletagmanager.com
5.3 %
1
wss.gopulsa.co.id:6001
5.3 %
1
google-analytics.com
5.3 %
1
TOTAL
100%
19
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Caching Test99% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 4.5 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

4.5 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Jasa tukar pulsa 24 jam sistem otomatis - Convert pulsa Melayani convert pulsa k...
Html: <div class="card-body pt-3">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.004. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.0037

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Pembelian Produk Transaksi Testimoni Hubungi
Html: <div class="d-flex align-items-stretch justify-content-between...">
Score: 0.0033
Server and security
Score: 86
Failed: 1
Warnings: 0
Passed: 8
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "tukar.co.id" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
tukar.co.id
Subject Alternative Names (SANs)
mail.tukar.co.id, tukar.co.id, www.tukar.co.id
Not valid before
Wed, August 24o 2022, 5:59:28 am (z)
Not valid after
Tue, November 22o 2022, 5:59:27 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R3
Intermediate certificate
Common name
R3
Organization
Let's Encrypt
Location
US
Not valid before
Fri, September 4o 2020, 12:00:00 am (z)
Not valid after
Mon, September 15o 2025, 4:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1, shrink-to-fit=no" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 45
Failed: 3
Warnings: 0
Passed: 6
Structured Data Test59% of top 100 sites passed
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test80% of top 100 sites passed
  • This website is using an Authorized Digital Sellers (ads.txt) file and its content has a valid format. Since the file is uploaded and maintained by publishers on their own domain, it's not easy for bad players to gain access to it or to change entries. Buyers who want to bid on the publisher's inventory can refer to their ads.txt file and confidently know that the exchange they are dealing with is in fact authorized to directly or indirectly sell the publisher's inventory.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved