seo site checkup logo
PricingFree ToolsArticles
Report generated 2 days ago
https://timus.in/collections/hard-luggage-trolley-bag
Your general SEO Checkup Score
Archived
71/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 71 out of 100, which is below the average score of 75. However, there are 18 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
18 Failed
4 Warnings
50 Passed
Issues to fix
HIGH
To provide a good user experience, Google recommends that sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.
HIGH
It is recommended to avoid URL parameters and to use hyphens to separate words in the URL structure, rather than underscores.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a First Contentful Paint value of 1.8 seconds or less.
MEDIUM
Reducing the JavaScript execution time can result in faster page load times and a smoother user experience, as it allows the browser to render and display the page more quickly.
MEDIUM
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
Common SEO issues
Score: 68
Failed: 5
Warnings: 3
Passed: 17
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 81 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Buy Lightweight & Stylish Hard Luggage Bags – Timus Lifestyle – Timus Life style
Length: 81 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 147 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Upgrade your travel style with Timus hard trolley bags. Lightweight, impact-resistant & airline-friendly. Find your perfect travel companion today!
Length: 147 characters
Google Search Results Preview Test
Desktop version
https://timus.in/collections/hard-luggage-trolley-bagBuy Lightweight & Stylish Hard Luggage Bags – Timus Lifestyle – Timus Life styleUpgrade your travel style with Timus hard trolley bags. Lightweight, impact-resistant & airline-friendly. Find your perfect travel companion today!
Mobile version
https://timus.in/collections/hard-luggage-trolley-bagBuy Lightweight & Stylish Hard Luggage Bags – Timus Lifestyle – Timus Life styleUpgrade your travel style with Timus hard trolley bags. Lightweight, impact-resistant & airline-friendly. Find your perfect travel companion today!
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:site_name
Timus Life style
og:url
https://timus.in/collections/hard-luggage-trolley-bag
og:title
Buy Lightweight & Stylish Hard Luggage Bags – Timus Lifestyle
og:type
website
og:description
Upgrade your travel style with Timus hard trolley bags. Lightweight, impact-resistant & airline-friendly. Find your perfect travel companion today!
og:image
http://timus.in/cdn/shop/collections/Hard-Luggage.jpg?v=1751438665
og:image:secure_url
https://timus.in/cdn/shop/collections/Hard-Luggage.jpg?v=1751438665
og:image:width
1920
og:image:height
600
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
66price47luggage35hard32regular20cart
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
price
luggage
hard
regular
cart
Keywords Cloud Test
applyavailabilitybackpackbackpacksbagsblackbluebusinesscabincalculatedcartcasualcategoriescheckcheckoutclaimclearcollaborationscolorcontentcontinuecorporatecustomersdesigneddetailsdiscountsdoubleduffleexclusivelyfacebookfiltergiftingglobalgreengreygrowinghappyhardincludedinstagramivorykeepinglaptoplargeleoliteloadinglocatorluggagemediummindneedsneolitenevyoliveorangeblackorderpolicypriceproductsprofessionalrangeregularremovereviewreviewssalesearchsetsshippingshoppingsinglesizeskipsoftsoldsortstarlitestockstorestudiosubtotalsunlitesupporttaxestimetimustimusbuiltbyfriendstracktraveltravelerstripletrolleytrulytwitteruniturbanviewwarrantyyellowyoutube
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Hard Luggage Trolley Bag
H2 tags
Your cart is empty
Cart
Subtotal
Filter and sort
Filter
Sort by:
Support
Quick links
Subscribe to our emails
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
SEO Friendly URL Test29% of top 100 sites passed
  • This webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test10% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test27% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Social Media Test75% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook 
Speed optimizations
Score: 63
Failed: 9
Warnings: 0
Passed: 16
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,361 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 574.55 Kb to 77.34 Kb (87% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 10.37 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 3.5 seconds! When the JavaScript code takes a long time to execute, it slows down the page performance in several ways: longer download times, main thread bottlenecks, delays of "Time To Interactive", memory leaks, etc.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
65.7 %
2.75 Mb
image
23.7 %
1015.51 Kb
css
4.4 %
189.31 Kb
html
3.7 %
157.44 Kb
font
1.9 %
79.60 Kb
other
0.6 %
25.22 Kb
TOTAL
100%
4.18 Mb
Requests by content type
Content type
Percent
Requests
image
35.8 %
100
javascript
30.1 %
84
css
18.6 %
52
other
10.0 %
28
html
3.9 %
11
font
1.4 %
4
TOTAL
100%
279
Content size by domain
Domain
Percent
Size
timus.in
36.9 %
1.54 Mb
cdn.shopify.com
20.9 %
895.66 Kb
fastrr-boost-ui.pickrr.com
18.4 %
787.08 Kb
googletagmanager.com
9.3 %
398.02 Kb
sr-cdn.shiprocket.in
2.7 %
114.87 Kb
connect.facebook.net
2.3 %
98.57 Kb
cdnwidget.judge.me
2.3 %
97.17 Kb
t.makehook.ws
1.3 %
55.12 Kb
fonts.shopifycdn.com
0.9 %
39.49 Kb
x.nitrocommerce.ai
0.9 %
38.11 Kb
Other
4.2 %
177.97 Kb
TOTAL
100%
4.18 Mb
Requests by domain
Domain
Percent
Requests
timus.in
58.8 %
164
cdn.shopify.com
12.9 %
36
fastrr-boost-ui.pickrr.com
6.5 %
18
t.makehook.ws
2.5 %
7
cdnwidget.judge.me
1.8 %
5
googletagmanager.com
1.4 %
4
n.clarity.ms
1.4 %
4
sr-cdn.shiprocket.in
1.1 %
3
unpkg.com
0.7 %
2
cdn.jsdelivr.net
0.7 %
2
Other
12.2 %
34
TOTAL
100%
279
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test95% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test100% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.768 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.768 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 3.639 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

3.639 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 4.04 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

4.04 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img src="//timus.in/cdn/shop/collections/Hard-Luggage.jpg?v..." width="100%">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0003. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0003

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Luggage Backpack Duffle Business Range
Html: <ul class="list-menu list-menu--inline" role="list">
Score: 0.0003
Server and security
Score: 93
Failed: 1
Warnings: 0
Passed: 9
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "timus.in" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
timus.in
Subject Alternative Names (SANs)
timus.in
Not valid before
Tue, July 29o 2025, 6:50:22 am (z)
Not valid after
Mon, October 27o 2025, 7:50:15 am (z)
Signature algorithm
ecdsaWithSha256
Issuer
WE1
Intermediate certificate
Common name
WE1
Organization
Google Trust Services
Location
US
Not valid before
Wed, December 13o 2023, 9:00:00 am (z)
Not valid after
Tue, February 20o 2029, 2:00:00 pm (z)
Signature algorithm
ecdsaWithSha384
Issuer
GTS Root R4
Root certificate
Common name
GTS Root R4
Organization
Google Trust Services LLC
Location
US
Not valid before
Wed, June 22o 2016, 12:00:00 am (z)
Not valid after
Sun, June 22o 2036, 12:00:00 am (z)
Signature algorithm
ecdsaWithSha384
Issuer
GTS Root R4
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=7889238
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test95% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width,initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 60
Failed: 3
Warnings: 1
Passed: 5
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://timus.in/collections/hard-luggage-trolley-bag is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://timus.in/collections/hard-luggage-trolley-bag" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved