seo site checkup logo
PricingFree ToolsArticles
Report generated 2 years ago
https://thecoolstufftobuy.com
Your general SEO Checkup Score
Archived
77/100
SEO Score
Average SEO score of top 100 sites: 74%
This website received an SEO score of 77 out of 100, which is higher than the average score of 74. Our analysis has identified 15 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
15 Failed
1 Warnings
52 Passed
Common SEO issues
Score: 74
Failed: 5
Warnings: 0
Passed: 21
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: TheCoolStuffToBuy - Internet's Coolest Market
Length: 45 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: TheCoolStuffToBuy is a free online magazine run by a group of geeks who shop too much online. Our philosophy is simple: we just want to showcase the coolest stuff to buy on the internet
Length: 185 characters
Google Search Results Preview Test
Desktop version
https://thecoolstufftobuy.comTheCoolStuffToBuy - Internet's Coolest MarketTheCoolStuffToBuy is a free online magazine run by a group of geeks who shop too much online. Our philosophy is simple: we just want to showcase the coolest stuff to buy on the internet
Mobile version
https://thecoolstufftobuy.comTheCoolStuffToBuy - Internet's Coolest MarketTheCoolStuffToBuy is a free online magazine run by a group of geeks who shop too much online. Our philosophy is simple: we just want to showcase the coolest stuff to buy on the internet
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_US
og:type
website
og:title
TheCoolStuffToBuy - Internet's Coolest Market
og:description
TheCoolStuffToBuy is a free online magazine run by a group of geeks who shop too much online. Our philosophy is simple: we just want to showcase the coolest stuff to buy on the internet
og:url
https://thecoolstufftobuy.com/
og:site_name
TheCoolStuffToBuy
og:updated_time
2022-08-25T10:17:32+00:00
og:image
https://thecoolstufftobuy.com/wp-content/uploads/2021/10/Logo2-Dark-800.png
og:image:secure_url
https://thecoolstufftobuy.com/wp-content/uploads/2021/10/Logo2-Dark-800.png
og:image:width
800
og:image:height
212
og:image:alt
thecoolstufftobuy
og:image:type
image/png
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
11check6thermal5gifts5gadgets5light
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are not appearing in one or more of the meta-tags above! Primary keywords should appear in meta-tags to help identify the topic of a webpage to search engines.
Keyword(s) not included in Title tag
Keyword(s) not included in Meta-Description tag
Keywords Cloud Test
adorneamazingapparelautosbankbatterybestbiemboughtbuttercameracategorieschargercheckchildchristmasclassycompanioncouplescutecuterdefinitelydeskdevicedisplaydrinkduckfireplacefitnessfoldingfoodfreshgadgetsgamesgardengeekygiftgiftsgluegoodgreatguideshalloweenhaveheadheatherbshighesthomehottestiphonejustkidskitchenlatestlightlithiumlowestmakesmilitarymoldableneednightoutdoorsoutletperfectpetsphonepopularpowerpoweredpriceproductrandomrechargeablerecipientridiculousscreenseeksellersimpleskypatiosolarsportsspraysprayersugrusunjacktabletoptechthecoolstufftobuythermaltoolsturneduniqueusedwalletwentwomenwork
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
CUTE DUCK NIGHT LIGHT
iPhone Thermal Camera – Seek Thermal XR Imager
Pelican 0955 – The Ultimate Sports Wallet
Biem Butter Sprayer
Adorne Pop-Out Outlet
Skypatio – the Tabletop Fireplace
SunJack – Military Folding Solar Charger
Ztylus – Car Window Breaker, Seatbelt Cutter
Prepara Herb Savor Pods
BOYO – Coolest Car Head Display
Sugru Moldable Glue – Fix and Repair Nearly Anything
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test40% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test80% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 71
Failed: 6
Warnings: 1
Passed: 13
HTML Page Size Test34% of top 100 sites passed
  • The size of this webpage's HTML is 15.14 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,395 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 75.8 Kb to 15.14 Kb (80% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage is around 3.73 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
51.2 %
747.26 Kb
image
21.3 %
310.68 Kb
font
13.3 %
194.54 Kb
html
6.8 %
99.52 Kb
css
5.3 %
77.78 Kb
other
2.0 %
28.48 Kb
TOTAL
100%
1.42 Mb
Requests by content type
Content type
Percent
Requests
javascript
32.3 %
21
image
23.1 %
15
html
20.0 %
13
font
12.3 %
8
css
6.2 %
4
other
6.2 %
4
TOTAL
100%
65
Content size by domain
Domain
Percent
Size
thecoolstufftobuy.com
32.0 %
467.28 Kb
pagead2.googlesyndication.com
18.7 %
272.38 Kb
gstatic.com
12.3 %
180.09 Kb
res-a.akamaihd.net
7.8 %
113.09 Kb
contextual.media.net
6.5 %
94.37 Kb
googletagmanager.com
4.4 %
63.93 Kb
warp.media.net
4.2 %
61.75 Kb
fonts.gstatic.com
3.9 %
57.30 Kb
googletagservices.com
3.0 %
44.34 Kb
google.com
2.8 %
40.26 Kb
Other
4.4 %
63.46 Kb
TOTAL
100%
1.42 Mb
Requests by domain
Domain
Percent
Requests
thecoolstufftobuy.com
29.2 %
19
pagead2.googlesyndication.com
12.3 %
8
google.com
7.7 %
5
tpc.googlesyndication.com
7.7 %
5
fonts.gstatic.com
6.2 %
4
gstatic.com
4.6 %
3
googleads.g.doubleclick.net
4.6 %
3
contextual.media.net
4.6 %
3
res-a.akamaihd.net
4.6 %
3
fonts.googleapis.com
3.1 %
2
Other
15.4 %
10
TOTAL
100%
65
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Caching Test99% of top 100 sites passed
See results list
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is not using cache headers for JavaScript resources! Setting cache headers can help to speed up the webpage for returning users.
See results list
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 91
Failed: 1
Warnings: 0
Passed: 8
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "thecoolstufftobuy.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
thecoolstufftobuy.com
Subject Alternative Names (SANs)
thecoolstufftobuy.com
Not valid before
Mon, September 5o 2022, 7:44:30 am (z)
Not valid after
Sun, December 4o 2022, 7:44:29 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R3
Intermediate certificate
Common name
R3
Organization
Let's Encrypt
Location
US
Not valid before
Fri, September 4o 2020, 12:00:00 am (z)
Not valid after
Mon, September 15o 2025, 4:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 82
Failed: 3
Warnings: 0
Passed: 7
Structured Data Test59% of top 100 sites passed
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://thecoolstufftobuy.com is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://thecoolstufftobuy.com/" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • The robots.txt file disallow the search engines access to some parts of your website! You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test80% of top 100 sites passed
  • This website is using an Authorized Digital Sellers (ads.txt) file and its content has a valid format. Since the file is uploaded and maintained by publishers on their own domain, it's not easy for bad players to gain access to it or to change entries. Buyers who want to bid on the publisher's inventory can refer to their ads.txt file and confidently know that the exchange they are dealing with is in fact authorized to directly or indirectly sell the publisher's inventory.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2024 • All rights reserved