seo site checkup logo
PricingFree ToolsArticles
Report generated 7 years ago
https://surveyforcustomers.com/tellthebell-com
Your general SEO Checkup Score
Archived
85/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 85 out of 100, which is higher than the average score of 75. Our analysis has identified 7 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
7 Failed
1 Warnings
41 Passed
Common SEO issues
Score: 76
Failed: 4
Warnings: 1
Passed: 16
Meta Title
  • Congratulations! Your webpage is using a title tag
Text: TellTheBell: Win $500 + Gifts Using Tell The Bell Survey (AUG 2018)
Meta Description
  • Congratulations! Your webpage is using a meta description tag
Text: Latest & Updated (August 2018) Guide of Tell The Bell at Tellthebell.com. TellTheBell Survey (www.tellthebell.com). Tell The Bell helps you win 500$ by enrolling in Tellthebell Survey, accessing the TellTheBell official website
Google Search Results Preview
Desktop version
https://surveyforcustomers.com/tellthebell-comTellTheBell: Win $500 + Gifts Using Tell The Bell Survey (AUG 2018)Latest & Updated (August 2018) Guide of Tell The Bell at Tellthebell.com. TellTheBell Survey (www.tellthebell.com). Tell The Bell helps you win 500$ by enrolling in Tellthebell Survey, accessing the TellTheBell official website
Mobile version
https://surveyforcustomers.com/tellthebell-comTellTheBell: Win $500 + Gifts Using Tell The Bell Survey (AUG 2018)Latest & Updated (August 2018) Guide of Tell The Bell at Tellthebell.com. TellTheBell Survey (www.tellthebell.com). Tell The Bell helps you win 500$ by enrolling in Tellthebell Survey, accessing the TellTheBell official website
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
151survey150bell88tell75taco42tellthebell
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud
accountanswerbeefbellburgercaffecanadacashchanceclickcodeconditionscontactcustomercustomersdatedetailsdigitdon’teasyenterentryenvironmentexperiencefeedbackfollowfoodfreeguidehandhopeinfographicingredientsjulyjunekinglikelinkmindmycfavisitmykfcexperiencenecessaryneedneronotificationnumberofficialonlineoverallpeopleperiodphonepotatoprizeprizesproblemqualityquestionquestionsratereceiptrecommendrelatedreplyresidentrestaurantrulessatisfactionsatisfiedsaysselectserviceservicessimplesoupstartstartingstatesstepstoresurveysurveyssweepstakestacotacostelltellthebelltellthebell.comthingstimeunitedupdatedusingvisitwantswebsitewinnerwinnerswinningwww.tellthebell.com
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your page contains too many H2 tags. H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Simple Guide To Taco Bell TellTheBell Customer Satisfaction Survey (2018)
TellTheBell
H2 tags
TellTheBell Survey At www.TellTheBell.com
Quick Guide to Take Tell The Bell Survey – See Infographic Below:
About Tell The Bell – See Infographic
What is Tell The Bell Taco Bell Customer Service Survey?
See Our Homemade Recipes Below If You are a Food lover
Official Social Media Account Of Taco Bell
See Related Food Customer Satisfaction Surveys Below:
Updated Step by Step Guide of Taco Bell Tell The Bell
Tell The Bell Taco Bell Customer Survey (www.tellthebell.com)
What Basically Tell The Bell Customer Survey Wants
More Food Customer Satisfaction Surveys Below
See This If you are a Resident of Canada Then Tell The Bell Canada is for you
TellTheBell Survey Prize
Tell The Bell Survey Rules
TellTheBell Survey Details
TellTheBell Survey: Entry Period
TELLTHEBELL Survey: Entry Methods
How To Take Part in TellTheBell Survey using www.tellthebell.com?
What are things necessary to start Tell The Bell Survey?
Easy Steps Taco Bell Customer Satisfaction Survey
Easy Step by Step Guide for Taco Bell Survey
TelltheBell.com Survey HomePage
www.tellthebell.com Survey Questions
Now we hope You will Visit Tellthebell.com
When Will You Get a message from TellTheBell Survey as Winners?
Tell The Bell Customer Service Winners Notification
Tell The Bell Winners Announcements At tellthebell.com
Tell The Bell Win 500 Cash
Taco Bell Survey Phone Number
See Other Food Survey Below
Robots.txt Test
  • This website is using a robots.txt file.
https://surveyforcustomers.com/robots.txt
Sitemap Test
  • Congratulations! Your website has a sitemap file.
https://surveyforcustomers.com/sitemap.xml
https://surveyforcustomers.com/sitemap_index.xml
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test
  • Your webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test
  • All of your webpage's "img" tags have the required "alt" attribute.
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags
  • We found some HTML deprecated tags. You are advised to change these old tags with equivalent tags or proper CSS rules.
17u
Google Analytics Test
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your webpage.
Social Media Check
  • Congratulations! Your website is connected successfully with social media using:
Facebook Pinterest Twitter 
Speed optimizations
Score: 86
Failed: 1
Warnings: 0
Passed: 12
HTML Page Size Test
  • Congratulations! The size of your webpage's HTML is 27.49 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 128.41 Kb to 27.49 Kb (79% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 2.04 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
  • Congratulations, your page has fewer than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from your server, which will ultimately slow down the loading of your web page.
Total Objects: 11
  • 1 HTML Pages
  • 2 CSS Files
  • 7 JS Files
  • 1 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Congratulations! Your webpage is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Minification Test
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test
  • Some of your website's CSS files are not minified!
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Checker
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 100
Failed: 0
Warnings: 0
Passed: 6
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 70
Failed: 2
Warnings: 0
Passed: 5
Microdata Schema Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://surveyforcustomers.com/tellthebell-com/ should be the preferred version of this page. The canonical tag can be useful when there are similar versions of the same content on several URLs (e.g., such as e-commerce sites where URL modifiers like sort parameters are appended to a product page's URL). Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://surveyforcustomers.com/tellthebell-com/" rel="canonical"/>
Nofollow Checker
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
See results list
Disallow Directive Checker
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF records checker
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 a mx include:websitewelcome.com ~all
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.

Check your website's SEO
Analyze and monitor your SEO with our powerful SEO ToolBox
Try the new features of our supercharged SEO ToolBox using a 7-day free trial account
seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
Company
Legal
© SEO Site Checkup 2020-2025 • All rights reserved