seo site checkup logo
PricingFree ToolsArticles
Report generated 3 years ago
https://store.epicgames.com/en-US/p/fortnite
Your general SEO Checkup Score
Archived
80/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 80 out of 100, which is higher than the average score of 75. Our analysis has identified 18 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
18 Failed
5 Warnings
44 Passed
Common SEO issues
Score: 58
Failed: 6
Warnings: 3
Passed: 13
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Fortnite | Download & Play For Free - Epic Games Store
Length: 54 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 148 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Download and play Fortnite Battle Royale and Creative mode for free at the Epic Games Store. Check out our Bundles, V-Bucks and various DLC as well!
Length: 148 characters
Google Search Results Preview Test
Desktop version
https://store.epicgames.com/en-US/p/fortniteFortnite | Download & Play For Free - Epic Games StoreDownload and play Fortnite Battle Royale and Creative mode for free at the Epic Games Store. Check out our Bundles, V-Bucks and various DLC as well!
Mobile version
https://store.epicgames.com/en-US/p/fortniteFortnite | Download & Play For Free - Epic Games StoreDownload and play Fortnite Battle Royale and Creative mode for free at the Epic Games Store. Check out our Bundles, V-Bucks and various DLC as well!
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:url
https://store.epicgames.com/en-US/p/fortnite
og:locale
en-US
og:site_name
Epic Games Store
og:title
Fortnite | Download & Play For Free - Epic Games Store
og:description
Download and play Fortnite Battle Royale and Creative mode for free at the Epic Games Store. Check out our Bundles, V-Bucks and various DLC as well!
og:type
website
og:image:alt
Fortnite | Download & Play For Free - Epic Games Store
og:image
https://cdn1.epicgames.com/offer/fn/22BR_FNMRS_EGS_Launcher_PDP_2560x1440_2560x1440-67c3376c5fd4d2abab2e95f9d743264c
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
40fortnite22battle20epic17games16build
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
fortnite
battle
epic
games
build
Keywords Cloud Test
accessactionagencyamazingbattlebestbucksbuildbuildingbuildscartchaptercharacterschoosechromecompetitivecontentcontrolscreatecreativecreatorcrewdiscoverdownloadearnengineepicespañolfollowfortnitefreefriendsgamegamesgenresglidersgwenhavehelpincludedincludesitemitemslikelogomembersmonstersmonthmonthlymultiplayeronlineopensopponentsoutfitoutfitspackpageparadisepasspickaxesplatformplayplayerplayerspolicypurchasepurchasespurequestsquicklyratingsreadrealityreleaserenegadesreviewroyalesaveseasonsharpspainsprintstoresubscriptionsupporttesttournamenttrademarkstraversalunderstoodunrealusedvictoryweaponwindowwindowswishlistwolfworldzero
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
FortniteFortnite
H2 tags
Fortnite Chapter 3 Season 4: Paradise
Play Your Way!
Take the offensive in Fortnite Zero Build No Build Battle Royale
Zero Build is a pure test of weapon, item, and traversal skill - no building required.
Battle. Build. Create.
Fortnite Crew
Add-Ons
Follow Us
Epic Player Ratings
Ratings
Specifications
Robots.txt Test94% of top 100 sites passed
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test75% of top 100 sites passed
  • This website lacks a sitemap file! Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Speed optimizations
Score: 58
Failed: 6
Warnings: 2
Passed: 8
HTML Page Size Test34% of top 100 sites passed
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,948 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 507.07 Kb to 119.61 Kb (76% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 11.87 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 2 seconds!
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
other
43.5 %
5.38 Mb
image
40.9 %
5.06 Mb
javascript
12.8 %
1.58 Mb
font
1.7 %
215.34 Kb
html
0.8 %
104.74 Kb
css
0.3 %
42.68 Kb
TOTAL
100%
12.38 Mb
Requests by content type
Content type
Percent
Requests
other
51.4 %
56
image
34.9 %
38
javascript
8.3 %
9
font
2.8 %
3
css
1.8 %
2
html
0.9 %
1
TOTAL
100%
109
Content size by domain
Domain
Percent
Size
cdn2.unrealengine.com
39.6 %
4.91 Mb
media-cdn.epicgames.com
39.5 %
4.89 Mb
static-assets-prod.epicgames.com
17.7 %
2.19 Mb
store.epicgames.com
1.6 %
200.08 Kb
cdn1.epicgames.com
1.0 %
122.01 Kb
cdn2.epicgames.com
0.3 %
38.97 Kb
tracking.epicgames.com
0.2 %
19.41 Kb
store-content-ipv4.ak.epicgames.com
0.1 %
18.35 Kb
epic-social-social-modules-prod.ol.epicgames.com
0.0 %
4.68 Kb
TOTAL
100%
12.38 Mb
Requests by domain
Domain
Percent
Requests
store.epicgames.com
31.2 %
34
cdn2.unrealengine.com
24.8 %
27
media-cdn.epicgames.com
13.8 %
15
static-assets-prod.epicgames.com
12.8 %
14
cdn2.epicgames.com
5.5 %
6
cdn1.epicgames.com
4.6 %
5
tracking.epicgames.com
3.7 %
4
store-content-ipv4.ak.epicgames.com
2.8 %
3
epic-social-social-modules-prod.ol.epicgames.com
0.9 %
1
TOTAL
100%
109
CDN Usage Test96% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test
  • This webpage is not using images with large metadata.
Image Caching Test99% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test96% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 76
Failed: 1
Warnings: 0
Passed: 5
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "store.epicgames.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
sni.cloudflaressl.com
Organization
Cloudflare, Inc.
Location
San Francisco, California, US
Subject Alternative Names (SANs)
sni.cloudflaressl.com, store.epicgames.com
Not valid before
Fri, August 26o 2022, 12:00:00 am (z)
Not valid after
Sat, August 26o 2023, 11:59:59 pm (z)
Signature algorithm
ecdsaWithSha256
Issuer
Cloudflare Inc ECC CA-3
Intermediate certificate
Common name
Cloudflare Inc ECC CA-3
Organization
Cloudflare, Inc.
Location
US
Not valid before
Mon, January 27o 2020, 12:48:08 pm (z)
Not valid after
Tue, December 31o 2024, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Baltimore CyberTrust Root
Root certificate
Common name
Baltimore CyberTrust Root
Organization
Baltimore
Location
IE
Not valid before
Fri, May 12o 2000, 6:46:00 pm (z)
Not valid after
Mon, May 12o 2025, 11:59:00 pm (z)
Signature algorithm
sha1WithRsaEncryption
Issuer
Baltimore CyberTrust Root
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
Plaintext Emails Test93% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1, user-scalable=no, minimal-ui" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 58
Failed: 3
Warnings: 0
Passed: 6
Structured Data Test59% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://store.epicgames.com/en-US/p/fortnite is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link data-react-helmet="true" data-testid="page-link-canonical" href="https://store.epicgames.com/en-US/p/fortnite" id="page-link-canonical" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
See results list
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test80% of top 100 sites passed
  • The access to the ads.txt file is restricted! Our request for this resource has returned a {status_code} HTTP status code. In order for this resource to be easily accessed by the DSPs and advertisers, its status code should be 200 OK.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved