seo site checkup logo
PricingFree ToolsArticles
Report generated 4 years ago
https://sp-energy.co.za/product/1kw-kool-energy-load-shedding-kit
Your general SEO Checkup Score
Archived
70/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 70 out of 100, which is below the average score of 75. However, there are 12 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
12 Failed
4 Warnings
37 Passed
Common SEO issues
Score: 75
Failed: 3
Warnings: 2
Passed: 16
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: 1Kw Kool Energy-Load Shedding Kit | Solar Panel Energy
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: Kool Energy 1Kw portable solar system - This 1Kw Kool Energy is ideal for load shedding. 100Ah AGM Battery - Plug & Play - No Installation - Solar Panel Ready
Google Search Results Preview Test
Desktop version
https://sp-energy.co.za/product/1kw-kool-energy-load-shedding-kit1Kw Kool Energy-Load Shedding Kit | Solar Panel EnergyKool Energy 1Kw portable solar system - This 1Kw Kool Energy is ideal for load shedding. 100Ah AGM Battery - Plug & Play - No Installation - Solar Panel Ready
Mobile version
https://sp-energy.co.za/product/1kw-kool-energy-load-shedding-kit1Kw Kool Energy-Load Shedding Kit | Solar Panel EnergyKool Energy 1Kw portable solar system - This 1Kw Kool Energy is ideal for load shedding. 100Ah AGM Battery - Plug & Play - No Installation - Solar Panel Ready
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
29solar14energy11battery9kool8inverters
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
accessoriesaccountaddressallgrandandersonbalancerbasketbatteriesbatteryboxesbracketsbreakersbulkcabinetscablecampingcartchargechargingcheckoutcnbmcombinerconnectorscontactcontrollercontrollersdetailsdeyedynessemailenergyfloodfoldablefrequencyfusegoodwegridgrowattholdershomehybridinclinputintelligentinverterinvertersisolatorskitskoollightlightinglightslithiumloadloadslugsminimodemonocrystallinemountingoliterordersoutputoverchargepackspanelpanelsphaseplasticplugspolycrystallineportportablepowerproductproductsprotectionpurepylontechrangeratedreliablerequiredreviewreviewsrevovsearchseraphimsheddingsineskykingsofarsolarstreetsurgesynapsesystemsvoltagewavewire
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your page contains too many H2 tags. H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
1Kw Kool Energy-Load Shedding Kit
H2 tags
Account
Reviews
Related products
Sofar 6000-ES 6kVA/6kW Hybrid Inverter
10A 12/24V PWM Solar Charge Controller
3KW 48V Growatt SPF Off-Grid Inverter
COMPANY
SHOP
YOUR ACCOUNT
CONTACT US
ADDRESS
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test
  • Your webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Social Media Test
  • Your website is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 41
Failed: 8
Warnings: 2
Passed: 6
HTML Page Size Test
  • Congratulations! The size of your webpage's HTML is 23.53 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 130.99 Kb to 23.53 Kb (82% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 7.69 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Total Objects: 82
  • 1 HTML Pages
  • 27 CSS Files
  • 37 JS Files
  • 17 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • It does not appear that you are caching your pages. Cached pages serve up static html and avoid potentially time consuming queries to your database. It also helps lower server load by up to 80%. Caching most visibly benefits high traffic pages that access a database, but whose content does not change on every page view. Common caching methods include Alternative PHP Cache, Quickcache, and WP Super Cache (for Wordpress sites). Caching mechanisms also typically compress HTML, further reducing page size and load time.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Image Caching Test
  • Your website is not using cache headers for your images. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
JavaScript Caching Test
  • Your website is not using cache headers for your JavaScript resources. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site.
See results list
CSS Caching Test
  • Your website is not using cache headers for your CSS resources. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site.
See results list
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Some of your webpage's CSS resources are not minified.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test
  • Your URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 100
Failed: 0
Warnings: 0
Passed: 6
HTTPS Test
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 100
Failed: 1
Warnings: 0
Passed: 7
Structured Data Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Custom 404 Error Page Test
  • Congratulations, your website is using a custom 404 error page. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://sp-energy.co.za/product/1kw-kool-energy-load-shedding-kit is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://sp-energy.co.za/product/1kw-kool-energy-load-shedding-kit/" rel="canonical"/>
Nofollow Tag Test
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
See results list
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF Records Test
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 +mx +ip4:197.242.69.194 -all
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved