seo site checkup logo
PricingFree ToolsArticles
Report generated a day ago
https://shyam-lal-contractor.grexa.site
Your general SEO Checkup Score
Archived
74/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 74 out of 100, which is below the average score of 75. However, there are 12 SEO issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
12 Failed
5 Warnings
44 Passed
Issues to fix
HIGH
To address URL canonicalization issues, it is recommended to select a primary URL for your webpage and set up redirects from all other variations to the preferred one.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a Time To First Byte value of 0.8 seconds or less.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a First Contentful Paint value of 1.8 seconds or less.
MEDIUM
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Consider reducing the HTML size to improve loading times and retain visitors.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 77
Failed: 2
Warnings: 3
Passed: 17
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 91 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Shyam Lal contractor- Best Painter Service in Chandigarh - Painter in Sector 45, Chandigarh
Length: 91 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 250 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Shyam Lal Contractor is the leading painting and decorating service provider in Chandigarh with 28 years of expertise in Interior Design, Bathroom Renovation, Architectural Design, and Real Estate Construction. Our skilled team transforms spaces with
Length: 250 characters
Google Search Results Preview Test
Desktop version
https://shyam-lal-contractor.grexa.site/Shyam Lal contractor- Best Painter Service in Chandigarh - Painter in Sector 45, ChandigarhShyam Lal Contractor is the leading painting and decorating service provider in Chandigarh with 28 years of expertise in Interior Design, Bathroom Renovation, Architectural Design, and Real Estate Construction. Our skilled team transforms spaces with
Mobile version
https://shyam-lal-contractor.grexa.site/Shyam Lal contractor- Best Painter Service in Chandigarh - Painter in Sector 45, ChandigarhShyam Lal Contractor is the leading painting and decorating service provider in Chandigarh with 28 years of expertise in Interior Design, Bathroom Renovation, Architectural Design, and Real Estate Construction. Our skilled team transforms spaces with
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:title
Shyam Lal contractor- Best Painter Service in Chandigarh - Painter in Sector 45, Chandigarh
og:description
Shyam Lal Contractor is the leading painting and decorating service provider in Chandigarh with 28 years of expertise in Interior Design, Bathroom Renovation, Architectural Design, and Real Estate Construction. Our skilled team transforms spaces with
og:image
https://lh6.googleusercontent.com/-ZS_W17KHl0U/AAAAAAAAAAI/AAAAAAAAAAA/5DC76gE158c/s44-p-k-no-ns-nd/photo.jpg
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
22painting17service16best16painter12chandigarh
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
painting
service
best
painter
chandigarh
Keywords Cloud Test
amaramrinderapplyingarchitecturalbathroombestbrilliantcabinetcellingchandigarhcolourcommercialconstructionconsultationcontactcontractorcustomercustomersdecoratingdeliveringdesigndevanshdiscoverdoorestateexcellentexpertiseexploreexteriorfalseflatfloorinffurnishingsfurnituregallerygoodhappyhomehouseinnovationinteriorjagdharjibachhleadinglovemarblemonthsnumbersofferofferedpaintpainterpaintingperfectlypinkupoilshpolishpolishingprecisionpressureproductspropertprovenprovideproviderqualityratedreadrealrenovationresidentialresultsreviewsrubysectorserviceservicesshyamskilledspacessuccesssuretanishkateamtexturetilestouchtransformstrustedunparalleleduserswallwallpaperwashingwaterproofingwoodwoodenworkyearyears
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Shyam Lal contractor- Best Painter Service in Chandigarh - Painter in Sector 45, Chandigarh
H2 tags
Painter Services by Shyam Lal contractor- Best Painter Service in Chandigarh
Painter Products by Shyam Lal contractor- Best Painter Service in Chandigarh
Gallery
Proven Success in Numbers
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Speed optimizations
Score: 75
Failed: 5
Warnings: 1
Passed: 14
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,336 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using zstd compression on your code. The HTML code is compressed from 246.59 Kb to 55.84 Kb (77% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 4.79 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
67.6 %
1.53 Mb
javascript
27.2 %
630.83 Kb
css
2.3 %
54.33 Kb
html
1.6 %
37.54 Kb
font
1.3 %
29.51 Kb
other
0.0 %
643 B
TOTAL
100%
2.27 Mb
Requests by content type
Content type
Percent
Requests
image
51.5 %
34
javascript
36.4 %
24
css
4.5 %
3
html
3.0 %
2
other
3.0 %
2
font
1.5 %
1
TOTAL
100%
66
Content size by domain
Domain
Percent
Size
lh3.googleusercontent.com
66.1 %
1.50 Mb
shyam-lal-contractor.grexa.site
13.0 %
300.81 Kb
maps.googleapis.com
11.3 %
262.85 Kb
googletagmanager.com
6.9 %
160.25 Kb
maps.gstatic.com
2.6 %
59.44 Kb
lh6.googleusercontent.com
0.1 %
2.33 Kb
google.com
0.1 %
1.87 Kb
TOTAL
100%
2.27 Mb
Requests by domain
Domain
Percent
Requests
lh3.googleusercontent.com
47.0 %
31
shyam-lal-contractor.grexa.site
28.8 %
19
maps.googleapis.com
18.2 %
12
lh6.googleusercontent.com
1.5 %
1
googletagmanager.com
1.5 %
1
google.com
1.5 %
1
maps.gstatic.com
1.5 %
1
TOTAL
100%
66
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is not using render-blocking resources.
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 1.897 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

1.897 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 3.160 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

3.16 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 3.16 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

3.16 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Shyam Lal contractor- Best Painter Service in Chandigarh - Painter in Sector 45,...
Html: <h1 class="mt-3 lh-sm heading-1 long-title">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0000. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.
0
Server and security
Score: 58
Failed: 3
Warnings: 0
Passed: 4
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "shyam-lal-contractor.grexa.site" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.grexa.site
Subject Alternative Names (SANs)
*.grexa.site, grexa.site
Not valid before
Mon, September 29o 2025, 12:00:00 am (z)
Not valid after
Tue, September 29o 2026, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Sectigo Public Server Authentication CA DV R36
Intermediate certificate
Common name
Sectigo Public Server Authentication CA DV R36
Organization
Sectigo Limited
Location
GB
Not valid before
Mon, March 22o 2021, 12:00:00 am (z)
Not valid after
Fri, March 21o 2036, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
Sectigo Public Server Authentication Root R46
Root certificate
Common name
Sectigo Public Server Authentication Root R46
Organization
Sectigo Limited
Location
GB
Not valid before
Mon, March 22o 2021, 12:00:00 am (z)
Not valid after
Wed, March 21o 2046, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
Sectigo Public Server Authentication Root R46
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 64
Failed: 2
Warnings: 1
Passed: 6
Structured Data Test66% of top 100 sites passed
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://shyam-lal-contractor.grexa.site/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://shyam-lal-contractor.grexa.site" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved