seo site checkup logo
PricingFree ToolsArticles
Report generated 2 years ago
https://sgxnifty.org
Your general SEO Checkup Score
Archived
78/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 78 out of 100, which is higher than the average score of 75. Our analysis has identified 14 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
14 Failed
3 Warnings
55 Passed
Common SEO issues
Score: 77
Failed: 4
Warnings: 2
Passed: 20
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 62 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: SGX Nifty | SGX Nifty Live | SGX Nifty Futures | Nifty Futures
Length: 62 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Get Current prices of SGX Nifty . Live & updated rates of SGX Nifty Futures & other Stock Market Futures . Nifty Nse India. Nifty Futures Quote, Nifty Futures
Length: 158 characters
Google Search Results Preview Test
Desktop version
https://sgxnifty.orgSGX Nifty | SGX Nifty Live | SGX Nifty Futures | Nifty FuturesGet Current prices of SGX Nifty . Live & updated rates of SGX Nifty Futures & other Stock Market Futures . Nifty Nse India. Nifty Futures Quote, Nifty Futures
Mobile version
https://sgxnifty.orgSGX Nifty | SGX Nifty Live | SGX Nifty Futures | Nifty FuturesGet Current prices of SGX Nifty . Live & updated rates of SGX Nifty Futures & other Stock Market Futures . Nifty Nse India. Nifty Futures Quote, Nifty Futures
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:type
website
og:title
SGX Nifty | SGX Nifty Live | SGX Nifty Futures | Nifty Futures
og:description
Get Current prices of SGX Nifty . Live & updated rates of SGX Nifty Futures & other Stock Market Futures . Nifty Nse India. Nifty Futures Quote, Nifty Futures Singapore
og:url
https://sgxnifty.org/
og:site_name
SGX Nifty
og:image
https://sgxnifty.org/wp-content/uploads/2019/03/sgx_nifty_color.png
og:image:secure_url
https://sgxnifty.org/wp-content/uploads/2019/03/sgx_nifty_color.png
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
48nifty22market18futures18indian16singapore
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
nifty
market
futures
indian
singapore
Keywords Cloud Test
accountadviceallowsamchartsattractedaveragebearishbrokeragebullishchangechartchoosecommentscontactcontinentcontractsderivativedifferentdirectiondisclaimerdiscussiondoesdollarexchangeextremelyfacilitatingfinancialforeignforumftsefuturefutureshavehighhistoricalhourhoursindexindiaindianindicesinitialintradayinvestinvestorsjavascriptlatestleadlivemarketmarketsmembersminutesmoneymonthmovementmovingnamesnasdaqnewsniftynikkeionlineopenopeningopenspaidperiodpolicypredictpriceprivacyproductprovidingquestrecommendationsreloadresistancerespectsettlementsgxniftysignalsingaporesolutionssomewhatstocksupporttechnicaltermsthingtimetimingstradetradedtradingtrendusedviewwebsiteworld
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
SGX Nifty
H2 tags
SGX Nifty Intraday Live Chart
SGX Nifty Historical Chart
About SGX Nifty
SGX NIFTY LIVE : FAQ
SGX Singapore Nifty
Singapore Nifty
Sgx Nifty Futures
Singapore Nifty Futures
SGX Aftermarket Future
Sgx Nifty Live
Sgx Nifty Future
Rules of Discussion on SGX Nifty
International
Latest News
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test40% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test38% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test72% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test33% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test80% of top 100 sites passed
  • This webpage is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 65
Failed: 8
Warnings: 0
Passed: 15
HTML Page Size Test34% of top 100 sites passed
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 23,194 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 378.06 Kb to 62.51 Kb (83% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 6.3 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 3.5 seconds! When the JavaScript code takes a long time to execute, it slows down the page performance in several ways: longer download times, main thread bottlenecks, delays of "Time To Interactive", memory leaks, etc.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
other
52.1 %
2.04 Mb
javascript
32.8 %
1.28 Mb
html
7.7 %
309.62 Kb
image
4.6 %
182.89 Kb
font
2.4 %
96.42 Kb
css
0.4 %
16.97 Kb
TOTAL
100%
3.92 Mb
Requests by content type
Content type
Percent
Requests
other
47.4 %
108
javascript
27.6 %
63
image
14.5 %
33
html
8.3 %
19
css
1.8 %
4
font
0.4 %
1
TOTAL
100%
228
Content size by domain
Domain
Percent
Size
streaming.playstream.media
49.5 %
1.94 Mb
imasdk.googleapis.com
8.6 %
345.64 Kb
player.avplayer.com
7.9 %
317.09 Kb
pagead2.googlesyndication.com
5.9 %
236.01 Kb
cdn.jsdelivr.net
5.7 %
228.21 Kb
securepubads.g.doubleclick.net
5.3 %
214.67 Kb
s0.2mdn.net
4.0 %
161.12 Kb
player.aniview.com
2.8 %
112.74 Kb
cdnjs.cloudflare.com
2.1 %
83.02 Kb
tpc.googlesyndication.com
1.7 %
68.59 Kb
Other
6.4 %
258.71 Kb
TOTAL
100%
3.92 Mb
Requests by domain
Domain
Percent
Requests
pubads.g.doubleclick.net
28.9 %
66
adservice.google.com
10.5 %
24
track1.aniview.com
10.1 %
23
pagead2.googlesyndication.com
6.6 %
15
cm.g.doubleclick.net
6.6 %
15
cdn.jsdelivr.net
4.8 %
11
tpc.googlesyndication.com
4.4 %
10
track1.avplayer.com
3.1 %
7
sgxnifty.org
2.6 %
6
googleads.g.doubleclick.net
2.6 %
6
Other
19.7 %
45
TOTAL
100%
228
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test99% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 0.56 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

0.56 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img src="https://cdn.jsdelivr.net/gh/imediacdn/wp-themes@ma..." width="300px" height="200px" alt="Subscribe">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.005. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.0049

0.1

0.25

DOM element which contributes the most to CLS score:
Html: <div class="avp-floating-container avp-p-wrapper" avp="" _45bf0b40="" id="aniplayer_AV636b76724788d25e303e5888-1668650948493..." style="bottom: 10px; left: 10px; transform-origin: left b...">
Score: 0.0049
Server and security
Score: 97
Failed: 1
Warnings: 0
Passed: 9
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "sgxnifty.org" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
sni.cloudflaressl.com
Organization
Cloudflare, Inc.
Location
San Francisco, California, US
Subject Alternative Names (SANs)
sni.cloudflaressl.com, sgxnifty.org, *.sgxnifty.org
Not valid before
Tue, July 12o 2022, 12:00:00 am (z)
Not valid after
Wed, July 12o 2023, 11:59:59 pm (z)
Signature algorithm
ecdsaWithSha256
Issuer
Cloudflare Inc ECC CA-3
Intermediate certificate
Common name
Cloudflare Inc ECC CA-3
Organization
Cloudflare, Inc.
Location
US
Not valid before
Mon, January 27o 2020, 12:48:08 pm (z)
Not valid after
Tue, December 31o 2024, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Baltimore CyberTrust Root
Root certificate
Common name
Baltimore CyberTrust Root
Organization
Baltimore
Location
IE
Not valid before
Fri, May 12o 2000, 6:46:00 pm (z)
Not valid after
Mon, May 12o 2025, 11:59:00 pm (z)
Signature algorithm
sha1WithRsaEncryption
Issuer
Baltimore CyberTrust Root
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, minimum-scale=1.0, initial-scale=1.0" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 98
Failed: 1
Warnings: 1
Passed: 8
Structured Data Test59% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://sgxnifty.org is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://sgxnifty.org/" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • The robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 a mx a:mailer.mailzig.com a:sgxnifty.org include:_spf.google.com -all
Ads.txt Validation Test80% of top 100 sites passed
  • This website is using an Authorized Digital Sellers (ads.txt) file, but it contains duplicated or invalid records! These warnings highlight points of concern which should not affect the processing of the authorized sellers list, but which should be resolved as soon as possible.
See results list
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved